SitesBLAST
Comparing 5207779 FitnessBrowser__PV4:5207779 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yu6B Crystal structure of mhst in complex with l-leucine (see paper)
33% identity, 98% coverage: 8:448/452 of query aligns to 4:439/446 of 6yu6B
6yu5A Crystal structure of mhst in complex with l-valine (see paper)
33% identity, 98% coverage: 8:448/452 of query aligns to 4:439/441 of 6yu5A
6yu3A Crystal structure of mhst in complex with l-phenylalanine (see paper)
33% identity, 98% coverage: 8:448/452 of query aligns to 4:439/441 of 6yu3A
6yu2A Crystal structure of mhst in complex with l-isoleucine (see paper)
33% identity, 98% coverage: 8:448/452 of query aligns to 4:439/441 of 6yu2A
4us3A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (see paper)
33% identity, 98% coverage: 8:448/452 of query aligns to 4:439/441 of 4us3A
- binding sodium ion: G17 (= G21), A19 (= A23), V20 (= V24), V20 (= V24), G21 (= G25), N24 (= N28), T224 (≠ S227), D256 (= D259), A313 (= A328), S316 (≠ T331), S317 (= S332)
- binding tryptophan: S18 (= S22), A19 (= A23), L22 (≠ V26), G23 (= G27), Y101 (= Y109), F223 (= F226), T224 (≠ S227), S226 (≠ T229), M229 (≠ T232), S320 (= S335), L321 (≠ I336)
6yu7A Crystal structure of mhst in complex with l-tyrosine (see paper)
33% identity, 98% coverage: 8:448/452 of query aligns to 4:439/442 of 6yu7A
6yu4A Crystal structure of mhst in complex with l-4f-phenylalanine (see paper)
33% identity, 98% coverage: 8:448/452 of query aligns to 4:439/442 of 6yu4A
- binding 4-fluoro-l-phenylalanine: S18 (= S22), A19 (= A23), G21 (= G25), L22 (≠ V26), G23 (= G27), Y101 (= Y109), F223 (= F226), T224 (≠ S227), S226 (≠ T229), M229 (≠ T232), L321 (≠ I336)
4us4A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (lipidic cubic phase form) (see paper)
33% identity, 96% coverage: 14:448/452 of query aligns to 1:430/433 of 4us4A
- binding (2s)-2,3-dihydroxypropyl(7z)-pentadec-7-enoate: A173 (≠ L185), T180 (= T192), I287 (≠ L309), R288 (≠ L312), L289 (≠ A313)
- binding sodium ion: G8 (= G21), S9 (= S22), A10 (= A23), V11 (= V24), V11 (= V24), N15 (= N28), T215 (≠ S227), D247 (= D259), A304 (= A328), S307 (≠ T331), S308 (= S332)
- binding tryptophan: S9 (= S22), A10 (= A23), G12 (= G25), G14 (= G27), Y92 (= Y109), F214 (= F226), T215 (≠ S227), S217 (≠ T229), M220 (≠ T232), L312 (≠ I336)
3gwwA Leucine transporter leut in complex with s-fluoxetine (see paper)
30% identity, 77% coverage: 8:355/452 of query aligns to 3:369/501 of 3gwwA
- binding leucine: A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y109), F244 (= F226), T245 (≠ S227), S247 (≠ T229), F250 (≠ T232), I350 (= I336)
- binding (3S)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (≠ V26), G22 (= G27), R26 (≠ G31), Y104 (= Y109), A310 (= A294), F311 (≠ D295)
Sites not aligning to the query:
3f3aA Crystal structure of leut bound to l-tryptophan and sodium (see paper)
30% identity, 77% coverage: 8:355/452 of query aligns to 3:371/504 of 3f3aA
- binding sodium ion: G16 (= G21), N17 (≠ S22), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), N23 (= N28), T247 (≠ S227), N279 (≠ T258), A344 (= A328), T347 (= T331), S348 (= S332)
- binding tryptophan: R7 (= R12), A18 (= A23), G20 (= G25), L21 (≠ V26), G22 (= G27), R26 (≠ G31), Y104 (= Y109), G242 (= G222), F246 (= F226), F246 (= F226), T247 (≠ S227), S249 (≠ T229), F252 (≠ T232), D265 (≠ Q245), Q266 (≠ E246), D267 (≠ N247), F299 (≠ V276), N303 (= N280), A306 (≠ Q283), I307 (= I284), A310 (= A287), N314 (≠ T296), S348 (= S332), I352 (= I336)
Sites not aligning to the query:
3uslA Crystal structure of leut bound to l-selenomethionine in space group c2 from lipid bicelles (see paper)
30% identity, 77% coverage: 8:355/452 of query aligns to 3:371/502 of 3uslA
- binding selenomethionine: A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y109), F246 (= F226), T247 (≠ S227), S249 (≠ T229), S348 (= S332), I352 (= I336)
- binding sodium ion: G16 (= G21), N17 (≠ S22), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), N23 (= N28), T247 (≠ S227), N279 (≠ T258), A344 (= A328), T347 (= T331), S348 (= S332)
- binding phosphocholine: N83 (≠ R88), R84 (≠ N89), F85 (≠ L90)
3usgA Crystal structure of leut bound to l-leucine in space group c2 from lipid bicelles (see paper)
30% identity, 77% coverage: 8:355/452 of query aligns to 3:371/502 of 3usgA
- binding leucine: A18 (= A23), G20 (= G25), G22 (= G27), F246 (= F226), T247 (≠ S227), S249 (≠ T229), F252 (≠ T232)
- binding sodium ion: G16 (= G21), N17 (≠ S22), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), N23 (= N28), T247 (≠ S227), N279 (≠ T258), A344 (= A328), T347 (= T331), S348 (= S332)
- binding phosphocholine: N83 (≠ R88), R84 (≠ N89)
3gwvA Leucine transporter leut in complex with r-fluoxetine (see paper)
30% identity, 77% coverage: 8:355/452 of query aligns to 3:372/498 of 3gwvA
- binding leucine: A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y109), F247 (= F226), T248 (≠ S227), S250 (≠ T229), F253 (≠ T232)
- binding (3R)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (≠ V26), R26 (≠ G31), A313 (= A294), F314 (≠ D295)
Sites not aligning to the query:
3mpnA F177r1 mutant of leut (see paper)
30% identity, 77% coverage: 8:355/452 of query aligns to 3:372/505 of 3mpnA
- binding leucine: N17 (≠ S22), A18 (= A23), G20 (= G25), L21 (≠ V26), G22 (= G27), Y104 (= Y109), F247 (= F226), T248 (≠ S227), S250 (≠ T229), F253 (≠ T232), S349 (= S332)
- binding S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate: C171 (≠ I153)
Sites not aligning to the query:
2q6hA Crystal structure analysis of leut complexed with l-leucine, sodium, and clomipramine (see paper)
30% identity, 77% coverage: 8:355/452 of query aligns to 5:374/512 of 2q6hA
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R28 (≠ G31), Q32 (= Q35), R189 (≠ A170), F190 (≠ W171), I193 (≠ R174), F316 (≠ D295), F346 (≠ I327)
- binding leucine: A20 (= A23), G22 (= G25), G24 (= G27), Y106 (= Y109), F249 (= F226), T250 (≠ S227), S252 (≠ T229), F255 (≠ T232)
- binding sodium ion: G18 (= G21), A20 (= A23), V21 (= V24), V21 (= V24), G22 (= G25), N25 (= N28), T250 (≠ S227), N282 (≠ T258), A347 (= A328), T350 (= T331), S351 (= S332)
Sites not aligning to the query:
2qb4A Crystal structure analysis of leut complexed with l-leucine, sodium and desipramine (see paper)
30% identity, 77% coverage: 8:355/452 of query aligns to 3:372/510 of 2qb4A
- binding 3-(10,11-dihydro-5h-dibenzo[b,f]azepin-5-yl)-n-methylpropan-1-amine: R26 (≠ G31), V29 (≠ T34), Q30 (= Q35), I107 (≠ L112), R187 (≠ A170), F188 (≠ W171), I191 (≠ R174), A313 (= A294), F314 (≠ D295), F344 (≠ I327)
- binding leucine: A18 (= A23), G20 (= G25), L21 (≠ V26), G22 (= G27), Y104 (= Y109), F247 (= F226), T248 (≠ S227), S250 (≠ T229), F253 (≠ T232)
- binding sodium ion: G16 (= G21), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), N23 (= N28), T248 (≠ S227), N280 (≠ T258), A345 (= A328), T348 (= T331), S349 (= S332)
Sites not aligning to the query:
3gwuA Leucine transporter leut in complex with sertraline (see paper)
30% identity, 77% coverage: 8:355/452 of query aligns to 3:372/509 of 3gwuA
- binding leucine: A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y109), F247 (= F226), T248 (≠ S227), S250 (≠ T229), F253 (≠ T232)
- binding (1S,4S)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine: L25 (≠ W30), R26 (≠ G31), Y104 (= Y109), F247 (= F226), A313 (= A294)
Sites not aligning to the query:
3f4jA Crystal structure of leut bound to glycine and sodium (see paper)
30% identity, 77% coverage: 8:355/452 of query aligns to 3:372/509 of 3f4jA
- binding glycine: A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y109), F247 (= F226), T248 (≠ S227), S250 (≠ T229)
- binding sodium ion: G16 (= G21), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), G22 (= G27), N23 (= N28), T248 (≠ S227), N280 (≠ T258), A345 (= A328), G346 (= G329), T348 (= T331), S349 (= S332)
3f3dA Crystal structure of leut bound to l-methionine and sodium (see paper)
30% identity, 77% coverage: 8:355/452 of query aligns to 3:372/509 of 3f3dA
- binding methionine: N17 (≠ S22), A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y109), F247 (= F226), T248 (≠ S227), S250 (≠ T229), S349 (= S332), I353 (= I336)
- binding sodium ion: G16 (= G21), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), N23 (= N28), T248 (≠ S227), N280 (≠ T258), A345 (= A328), T348 (= T331), S349 (= S332)
3f3cA Crystal structure of leut bound to 4-fluoro-l-phenylalanine and sodium (see paper)
30% identity, 77% coverage: 8:355/452 of query aligns to 3:372/509 of 3f3cA
- binding sodium ion: G16 (= G21), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), N23 (= N28), T248 (≠ S227), N280 (≠ T258), A345 (= A328), T348 (= T331), S349 (= S332)
- binding 4-fluoro-l-phenylalanine: N17 (≠ S22), A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y109), F247 (= F226), T248 (≠ S227), S250 (≠ T229), F253 (≠ T232), S349 (= S332), I353 (= I336)
Query Sequence
>5207779 FitnessBrowser__PV4:5207779
MSAKDLGHFSSRIGFIMAAAGSAVGVGNIWGFPTQAATHGGGAFLLVYLVLIFLLGYPML
VAELMIGRHGQTNPADAMAKLGSSKLSRNLGKTIGFASIITATLICTFYSILSGWFVSFT
LAPIARLVGMQDIALWLTSFSLERNLLFTLIFILMVVLVIRQGVQQGIEAWSKRLMPLLL
AILILGVAYILTQPGASQGLNALLVPDFGRIWEPQVLIGALGQTFFSLTVGTGAMMVYGA
YLNRQENLAKLTAYVTLTDTSVAFLAALMIIPAMYVAQHNGVQIFAADGSLLNADTLVFT
VLPALFDSLGGLAGQLIAIVFFILMTIAGLTSAISIVEVPTSYMVEKTEIQRHSATYLVG
GGIALLATIMVFNFDALFALVITLTTERAQPFIALGIALYTGWVWHRNSLLKAIAAQEGA
KLDGLFWRIWPVYVKYVCPVLILAIILQLLTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory