Comparing 5207805 FitnessBrowser__PV4:5207805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
62% identity, 100% coverage: 2:414/414 of query aligns to 1:417/418 of 4xg1B
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
57% identity, 100% coverage: 2:414/414 of query aligns to 1:392/393 of 4xg1A
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
44% identity, 94% coverage: 21:411/414 of query aligns to 7:399/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
44% identity, 94% coverage: 21:411/414 of query aligns to 5:391/394 of 3c5qA
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
38% identity, 95% coverage: 21:414/414 of query aligns to 24:431/434 of 1twiA
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
38% identity, 95% coverage: 21:414/414 of query aligns to 24:431/434 of 1tufA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
38% identity, 95% coverage: 21:414/414 of query aligns to 28:435/438 of Q58497
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
40% identity, 94% coverage: 1:390/414 of query aligns to 1:398/422 of 6n2aA
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
38% identity, 94% coverage: 20:408/414 of query aligns to 5:381/385 of 2yxxA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
38% identity, 94% coverage: 20:408/414 of query aligns to 6:382/386 of Q9X1K5
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
33% identity, 94% coverage: 21:410/414 of query aligns to 33:444/446 of 1hkvA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
33% identity, 94% coverage: 21:410/414 of query aligns to 34:445/447 of P9WIU7
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
33% identity, 94% coverage: 21:410/414 of query aligns to 35:442/442 of 5x7nA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
33% identity, 94% coverage: 21:410/414 of query aligns to 35:442/443 of 5x7mA
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
32% identity, 97% coverage: 1:403/414 of query aligns to 1:411/420 of P00861
1knwA Crystal structure of diaminopimelate decarboxylase
32% identity, 97% coverage: 3:403/414 of query aligns to 2:410/421 of 1knwA
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
32% identity, 97% coverage: 3:403/414 of query aligns to 2:410/419 of 1ko0A
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
28% identity, 93% coverage: 14:400/414 of query aligns to 4:400/412 of 7ru7A
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
28% identity, 96% coverage: 4:399/414 of query aligns to 23:445/461 of 8d5rA
8d4iA Structure of y430f d-ornithine/d-lysine decarboxylase complex with putrescine (see paper)
28% identity, 96% coverage: 4:399/414 of query aligns to 23:447/462 of 8d4iA
>5207805 FitnessBrowser__PV4:5207805
MDHFLYQQDELYAEQCTVASLAETYGTPLYVYSRATLERHWHAFDNAVADHPHMICYAVK
ANSNLAVLNVLARLGSGFDIVSGGELARVLEAGGEASKVVFSGVGKTVAEMEMALEAGIY
CFNVESAAELEQLNLVALRLGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAMEEAEA
IFLRANELPGLAVKGADCHIGSQLTELQPFLDAMDRMLALIDRLAEQGVKIAHLDVGGGL
GVTYDGEQPPEPSAYASALLGKLAGRDLKLIFEPGRAIAANAGIFVTQVLYLKENAEKNF
ALVDGAMNDLIRPSLYSAWQKIIPVVPRPGETRQYDVVGPVCETGDFLGKDRALNIRAND
LLAVRSSGAYGFTMASNYNSRPRAAEVMVDGERHYLVREREKVAQLWQGEQLLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory