SitesBLAST
Comparing 5208014 FitnessBrowser__PV4:5208014 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
52% identity, 99% coverage: 3:372/375 of query aligns to 2:365/366 of 3dmeA
- binding flavin-adenine dinucleotide: I8 (= I9), G9 (= G10), G11 (= G12), V12 (= V13), V13 (= V14), E32 (≠ D33), A33 (≠ R34), T41 (≠ I42), S42 (= S43), R44 (= R45), N45 (= N46), S46 (= S47), V48 (= V49), H50 (= H51), P170 (≠ E171), L171 (≠ F172), A203 (= A204), I313 (= I319), R314 (= R320), I346 (= I353), E347 (= E354), S348 (= S355), P349 (= P356), G350 (= G357), L351 (= L358), T352 (= T359)
8w78A Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate (see paper)
28% identity, 92% coverage: 28:372/375 of query aligns to 29:403/410 of 8w78A
- binding 2-oxoglutaric acid: S48 (= S47), H52 (= H51), Y245 (= Y247), F254 (≠ G256), L255 (= L257), H258 (= H260), R349 (= R320)
- binding flavin-adenine dinucleotide: E34 (≠ D33), K35 (≠ R34), H42 (≠ G41), Q43 (≠ I42), S44 (= S43), N47 (= N46), S48 (= S47), V50 (= V49), H52 (= H51), V173 (≠ T174), G203 (≠ A204), G204 (= G205), Q206 (≠ F207), R349 (= R320), P387 (= P356), G388 (= G357), A389 (≠ L358), T390 (= T359)
Sites not aligning to the query:
8w7fB Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion (see paper)
28% identity, 92% coverage: 28:372/375 of query aligns to 29:405/412 of 8w7fB
- binding flavin-adenine dinucleotide: E34 (≠ D33), K35 (≠ R34), H42 (≠ G41), Q43 (≠ I42), S44 (= S43), H46 (≠ R45), N47 (= N46), S48 (= S47), V50 (= V49), H52 (= H51), V173 (≠ H169), G205 (≠ A204), G206 (= G205), Q208 (≠ F207), Y231 (= Y233), V350 (≠ I319), R351 (= R320), P389 (= P356), G390 (= G357), A391 (≠ L358), T392 (= T359)
Sites not aligning to the query:
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
26% identity, 99% coverage: 1:372/375 of query aligns to 1:365/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G10), G12 (= G12), I14 (≠ V14), E33 (≠ D33), K34 (≠ R34), E41 (≠ G41), T42 (≠ I42), S43 (= S43), A45 (≠ R45), N46 (= N46), S47 (= S47), V49 (= V49), H51 (= H51), E176 (= E171), V177 (≠ F172), A209 (= A204), G210 (= G205), Y212 (≠ F207), Y234 (= Y233), S319 (≠ I319), R320 (= R320), M346 (≠ I353), K347 (≠ E354), S348 (= S355), P349 (= P356), G350 (= G357), L351 (= L358), T352 (= T359)
- binding sn-glycerol-3-phosphate: S47 (= S47), H51 (= H51), K258 (≠ L257), G259 (= G258), R320 (= R320), S348 (= S355)
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
26% identity, 99% coverage: 1:372/375 of query aligns to 1:365/384 of P75063
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 59% coverage: 2:224/375 of query aligns to 41:260/857 of Q63342
- CV 52:53 (≠ VV 13:14) binding
- EK 73:74 (≠ DR 33:34) binding
- 80:88 (vs. 39:46, 11% identical) binding
- H84 (≠ S43) modified: Tele-8alpha-FAD histidine
- V212 (≠ F172) binding
- W244 (≠ F207) binding
Sites not aligning to the query:
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
24% identity, 59% coverage: 2:224/375 of query aligns to 4:223/824 of 4pabB
- active site: T53 (≠ E48), E102 (≠ Q101)
- binding flavin-adenine dinucleotide: I11 (= I9), G12 (= G10), G14 (= G12), C15 (≠ V13), V16 (= V14), L35 (≠ I32), E36 (≠ D33), K37 (≠ R34), G43 (= G39), S44 (≠ T40), T45 (≠ G41), H47 (≠ S43), A48 (≠ S44), A49 (≠ R45), G50 (≠ N46), L51 (vs. gap), V175 (≠ F172), A204 (= A204), G205 (= G205), W207 (≠ F207)
Sites not aligning to the query:
- active site: 226, 255, 536
- binding flavin-adenine dinucleotide: 226, 228, 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Query Sequence
>5208014 FitnessBrowser__PV4:5208014
MDKLDAIVIGAGVVGLAVAASLSRRFGNVLIIDRAETIGTGISSRNSEVIHAGIYYPTGS
LKAQLCVEGKRQLYAYCRRRGVAVNSLGKLIVATQVEQEAQLDALFTQARANGVDDLNPL
GRRQLQALEPALKASAGLLSPSTGIVDSHGLMLSLLAEAEEYGAIFCPHTEFITTQADAN
GFRVELMQQGERVSLETSFLINCAGLFATEVATRIEGLAESLVPQLYWCKGHYFAYQGKS
PFAHLIYPVPEPGLKGLGIHATIDLGGQLKFGPDAQYMVPDSLEDYRVPEALRQRFHQAI
ASYYPGIAIERLQTAYAGIRPKLQGPDDTEVADFLIQGEAQHGIPGLVNLLGIESPGLTA
SLAIAEQVSRQLVTP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory