SitesBLAST
Comparing 5208024 Shew_0540 enoyl-CoA hydratase/isomerase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7borA Structure of pseudomonas aeruginosa coa-bound odaa (see paper)
41% identity, 99% coverage: 4:245/245 of query aligns to 4:247/247 of 7borA
- active site: N63 (= N63), F68 (= F68), D77 (≠ N77), G81 (≠ V81), I105 (= I105), T108 (= T108), F128 (= F128), L133 (= L133), P135 (= P135), E136 (= E136), A222 (≠ Q220), L232 (= L230)
- binding coenzyme a: D21 (= D21), K22 (= K22), A25 (= A25), S61 (= S61), I65 (≠ V65), V103 (= V103), F128 (= F128), L131 (= L131), F244 (= F242), R247 (= R245)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
40% identity, 82% coverage: 7:208/245 of query aligns to 8:211/257 of 6slbAAA
- active site: Q64 (≠ N63), F69 (= F68), L80 (vs. gap), N84 (≠ V81), A108 (≠ I105), S111 (≠ T108), A130 (≠ P127), F131 (= F128), L136 (= L133), P138 (= P135), D139 (≠ E136)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ D57), A62 (≠ S61), Q64 (≠ N63), D65 (= D64), L66 (≠ V65), Y76 (≠ G75), A108 (≠ I105), F131 (= F128), D139 (≠ E136)
Sites not aligning to the query:
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
39% identity, 82% coverage: 7:208/245 of query aligns to 5:199/245 of 6slaAAA
- active site: Q61 (≠ N63), L68 (= L69), N72 (≠ D73), A96 (≠ I105), S99 (≠ T108), A118 (≠ P127), F119 (= F128), L124 (= L133), P126 (= P135), N127 (≠ E136)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ R23), A59 (≠ S61), Q61 (≠ N63), D62 (= D64), L63 (≠ V65), L68 (= L69), Y71 (≠ S72), A94 (≠ V103), G95 (= G104), A96 (≠ I105), F119 (= F128), I122 (≠ L131), L124 (= L133), N127 (≠ E136)
Sites not aligning to the query:
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 84% coverage: 3:208/245 of query aligns to 4:206/250 of 3q0gD
- active site: A64 (≠ N63), M69 (≠ F68), T75 (= T80), F79 (≠ L84), G103 (≠ I105), E106 (≠ T108), P125 (= P127), E126 (≠ F128), V131 (≠ L133), P133 (= P135), G134 (≠ E136)
Sites not aligning to the query:
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
31% identity, 99% coverage: 3:245/245 of query aligns to 5:251/259 of 5zaiC
- active site: A65 (≠ N63), F70 (= F68), S82 (≠ T86), R86 (vs. gap), G110 (≠ I105), E113 (≠ T108), P132 (= P127), E133 (≠ F128), I138 (≠ L133), P140 (= P135), G141 (≠ E136), A226 (≠ Q220), F236 (≠ L230)
- binding coenzyme a: K24 (= K22), L25 (≠ R23), A63 (≠ S61), G64 (= G62), A65 (≠ N63), D66 (= D64), I67 (≠ V65), P132 (= P127), R166 (≠ P161), F248 (= F242), K251 (≠ R245)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
32% identity, 84% coverage: 3:208/245 of query aligns to 4:210/256 of 3h81A
- active site: A64 (≠ N63), M69 (≠ F68), T79 (= T80), F83 (≠ L84), G107 (≠ I105), E110 (≠ T108), P129 (= P127), E130 (≠ F128), V135 (≠ L133), P137 (= P135), G138 (≠ E136)
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
32% identity, 84% coverage: 3:208/245 of query aligns to 5:211/255 of 3q0jC
- active site: A65 (≠ N63), M70 (≠ F68), T80 (= T80), F84 (≠ L84), G108 (≠ I105), E111 (≠ T108), P130 (= P127), E131 (≠ F128), V136 (≠ L133), P138 (= P135), G139 (≠ E136)
- binding acetoacetyl-coenzyme a: Q23 (≠ D21), A24 (≠ K22), L25 (≠ R23), A27 (= A25), A63 (≠ S61), G64 (= G62), A65 (≠ N63), D66 (= D64), I67 (≠ V65), K68 (≠ A66), M70 (≠ F68), F84 (≠ L84), G107 (= G104), G108 (≠ I105), E111 (≠ T108), P130 (= P127), E131 (≠ F128), P138 (= P135), G139 (≠ E136), M140 (≠ A137)
Sites not aligning to the query:
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 84% coverage: 3:208/245 of query aligns to 5:211/255 of 3q0gC
- active site: A65 (≠ N63), M70 (≠ F68), T80 (= T80), F84 (≠ L84), G108 (≠ I105), E111 (≠ T108), P130 (= P127), E131 (≠ F128), V136 (≠ L133), P138 (= P135), G139 (≠ E136)
- binding coenzyme a: L25 (≠ R23), A63 (≠ S61), I67 (≠ V65), K68 (≠ A66), Y104 (≠ P101), P130 (= P127), E131 (≠ F128), L134 (= L131)
Sites not aligning to the query:
6l3pA Crystal strcuture of feruloyl-coa hydratase lyase(fchl) complexed with coa
29% identity, 89% coverage: 1:218/245 of query aligns to 7:227/244 of 6l3pA
- active site: M69 (≠ N63), Y74 (≠ F68), R86 (≠ H78), Q90 (≠ R82), G114 (≠ I105), S117 (≠ T108), S136 (≠ P127), E137 (≠ F128), I142 (≠ L133), P144 (= P135), G145 (≠ E136)
- binding coenzyme a: K28 (= K22), R29 (= R23), A31 (= A25), A67 (≠ S61), M69 (≠ N63), D70 (= D64), L71 (≠ V65), G113 (= G104)
Sites not aligning to the query:
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
29% identity, 99% coverage: 4:245/245 of query aligns to 15:261/273 of Q5HH38
- R34 (= R23) binding in other chain
- SGGDQ 73:77 (≠ SGNDV 61:65) binding in other chain
- S149 (≠ L133) binding in other chain
6p5uE Structure of an enoyl-coa hydratase/aldolase isolated from a lignin- degrading consortium (see paper)
27% identity, 93% coverage: 1:227/245 of query aligns to 5:243/246 of 6p5uE
- active site: M67 (≠ N63), Y72 (≠ F68), D77 (= D73), R89 (vs. gap), A93 (≠ R82), G117 (≠ I105), T120 (= T108), E140 (≠ F128), I145 (≠ L133), P147 (= P135), A148 (≠ E136), A236 (≠ Q220)
- binding coenzyme a: D25 (= D21), K26 (= K22), R27 (= R23), A29 (= A25), A65 (≠ S61), M67 (≠ N63), D68 (= D64), L69 (≠ V65), W113 (≠ P101), F115 (≠ V103), S139 (≠ P127), W143 (≠ L131)
Sites not aligning to the query:
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
32% identity, 95% coverage: 14:245/245 of query aligns to 20:258/266 of O53561
- K135 (= K123) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 123:130, 25% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ N130) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
29% identity, 99% coverage: 4:245/245 of query aligns to 10:248/260 of 2uzfA
- active site: G70 (≠ N63), R80 (≠ N77), L84 (≠ V81), G108 (≠ I105), V111 (≠ T108), T130 (≠ P127), G131 (≠ F128), S136 (≠ L133), D138 (≠ P135), A139 (≠ E136), A225 (≠ E222), Y233 (≠ L230)
- binding acetoacetyl-coenzyme a: V28 (≠ K22), R29 (= R23), S68 (= S61), G69 (= G62), G70 (≠ N63), D71 (= D64), Y104 (≠ P101), G108 (≠ I105)
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
28% identity, 96% coverage: 12:245/245 of query aligns to 17:250/258 of 1mj3A
- active site: A68 (≠ N63), M73 (≠ L69), S83 (≠ P79), L85 (≠ V81), G109 (≠ I105), E112 (≠ T108), P131 (= P127), E132 (≠ F128), T137 (≠ L133), P139 (= P135), G140 (≠ E136), K225 (= K221), F235 (≠ L230)
- binding hexanoyl-coenzyme a: K26 (≠ D21), A27 (≠ K22), L28 (≠ R23), A30 (= A25), A66 (≠ S61), G67 (= G62), A68 (≠ N63), D69 (= D64), I70 (≠ V65), G109 (≠ I105), P131 (= P127), E132 (≠ F128), L135 (= L131), G140 (≠ E136)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
29% identity, 96% coverage: 12:245/245 of query aligns to 17:252/260 of 1dubA
- active site: A68 (≠ N63), M73 (≠ L69), S83 (≠ T80), L87 (= L84), G111 (≠ I105), E114 (≠ T108), P133 (= P127), E134 (≠ F128), T139 (≠ L133), P141 (= P135), G142 (≠ E136), K227 (= K221), F237 (≠ L230)
- binding acetoacetyl-coenzyme a: K26 (≠ D21), A27 (≠ K22), L28 (≠ R23), A30 (= A25), A66 (≠ S61), A68 (≠ N63), D69 (= D64), I70 (≠ V65), Y107 (≠ P101), G110 (= G104), G111 (≠ I105), E114 (≠ T108), P133 (= P127), E134 (≠ F128), L137 (= L131), G142 (≠ E136), F233 (= F226), F249 (= F242)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
29% identity, 96% coverage: 12:245/245 of query aligns to 15:250/258 of 1ey3A
- active site: A66 (≠ N63), M71 (≠ L69), S81 (≠ T80), L85 (= L84), G109 (≠ I105), E112 (≠ T108), P131 (= P127), E132 (≠ F128), T137 (≠ L133), P139 (= P135), G140 (≠ E136), K225 (= K221), F235 (≠ L230)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ D21), L26 (≠ R23), A28 (= A25), A64 (≠ S61), G65 (= G62), A66 (≠ N63), D67 (= D64), I68 (≠ V65), L85 (= L84), W88 (≠ L87), G109 (≠ I105), P131 (= P127), L135 (= L131), G140 (≠ E136)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
29% identity, 96% coverage: 12:245/245 of query aligns to 17:252/260 of 2hw5C
- active site: A68 (≠ N63), M73 (≠ L69), S83 (≠ T80), L87 (= L84), G111 (≠ I105), E114 (≠ T108), P133 (= P127), E134 (≠ F128), T139 (≠ L133), P141 (= P135), G142 (≠ E136), K227 (≠ Q220), F237 (≠ L230)
- binding crotonyl coenzyme a: K26 (≠ D21), A27 (≠ K22), L28 (≠ R23), A30 (= A25), K62 (≠ D57), I70 (≠ V65), F109 (≠ V103)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
29% identity, 96% coverage: 12:245/245 of query aligns to 47:282/290 of P14604
- E144 (≠ T108) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ F128) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
Q9P4U9 Enoyl-CoA hydratase AKT3-1; AF-toxin biosynthesis protein 3-1; EC 4.2.1.17 from Alternaria alternata (Alternaria rot fungus) (Torula alternata) (see paper)
28% identity, 97% coverage: 8:245/245 of query aligns to 21:263/296 of Q9P4U9
Sites not aligning to the query:
- 294:296 Peroxisomal targeting signal type 1
3p85A Crystal structure enoyl-coa hydratase from mycobacterium avium (see paper)
31% identity, 80% coverage: 9:203/245 of query aligns to 8:190/224 of 3p85A
- active site: L62 (≠ N63), L67 (≠ F68), P68 (≠ S72), G92 (≠ I105), E95 (≠ T108), T114 (≠ P127), H115 (≠ F128), L120 (= L133), P122 (= P135), T123 (≠ E136)
- binding calcium ion: D43 (= D44), D45 (≠ G46)
Sites not aligning to the query:
Query Sequence
>5208024 Shew_0540 enoyl-CoA hydratase/isomerase (RefSeq)
MSNIQFQDEQGVRIITINRPDKRNALNLEMYARLTEYLIQGESDNGINAFLLKGEGDCFT
SGNDVADFLKNSDLGQNHPTVRFLFTLLDLTKPLVAAVAGPAVGIGTTLLLHCDLVYADN
TAKFQLPFVNLALVPEAGASLLLPRLVGQTKASELLLLGEPFDAQSALSMGLINDLLPSD
ELMSHAMSQSIKLAKKPPQALRASRRLIRGDSELIREQMQKELEEFAVRLQSDEAKAQFN
AFLSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory