Comparing 5208211 FitnessBrowser__PV4:5208211 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
49% identity, 92% coverage: 1:220/240 of query aligns to 3:222/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
49% identity, 91% coverage: 1:218/240 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
49% identity, 91% coverage: 1:218/240 of query aligns to 1:223/230 of 1l2tA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
44% identity, 93% coverage: 1:222/240 of query aligns to 3:224/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
44% identity, 93% coverage: 1:222/240 of query aligns to 3:224/592 of 5lj7A
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
45% identity, 91% coverage: 1:218/240 of query aligns to 4:221/650 of 5ws4A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
45% identity, 91% coverage: 1:219/240 of query aligns to 3:217/223 of 2pclA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
42% identity, 91% coverage: 1:219/240 of query aligns to 4:222/648 of P75831
7mdyC Lolcde nucleotide-bound
43% identity, 91% coverage: 1:218/240 of query aligns to 2:220/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
43% identity, 91% coverage: 1:218/240 of query aligns to 2:220/222 of 7arlD
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
43% identity, 91% coverage: 1:218/240 of query aligns to 5:223/233 of P75957
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
42% identity, 91% coverage: 1:218/240 of query aligns to 4:222/229 of 7v8iD
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
42% identity, 83% coverage: 1:200/240 of query aligns to 2:198/225 of 8iddA
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
42% identity, 83% coverage: 1:200/240 of query aligns to 2:198/227 of 8igqA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
42% identity, 83% coverage: 1:200/240 of query aligns to 1:197/229 of A5U7B7
8g4cB Bceabs atpgs high res tm (see paper)
36% identity, 95% coverage: 1:228/240 of query aligns to 3:230/248 of 8g4cB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
38% identity, 90% coverage: 1:216/240 of query aligns to 2:211/241 of 4u00A
7tchB Bceab e169q variant atp-bound conformation (see paper)
35% identity, 95% coverage: 1:228/240 of query aligns to 2:229/245 of 7tchB
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
38% identity, 96% coverage: 1:230/240 of query aligns to 1:221/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
38% identity, 91% coverage: 1:218/240 of query aligns to 1:215/219 of 8w6iD
>5208211 FitnessBrowser__PV4:5208211
MLTMKNINKVFKTDLVETHALRDFNLEVKEGEFVAVTGPSGSGKTTFLNIAGLLEGFTNG
EYHLDDVNISNLSDNKAAAIRNEKIGFIFQGFNLIPDLNLAENVEVPLRYRGFNAKERQR
RVKAALEQVGLGARMKHLPSQLSGGQQQRVAIARALAGEPRFLLADEPTGNLDSLMARQV
MELLEEINKAGTTIIMVTHDPELARRAQRNIQIVDGQVCDFTLYQGGQSHLVDTAEKVAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory