SitesBLAST
Comparing 5208217 FitnessBrowser__PV4:5208217 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nt6A Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant (see paper)
100% identity, 100% coverage: 1:565/566 of query aligns to 1:565/565 of 3nt6A
- active site: A11 (= A11), V38 (= V38), N42 (= N42), S43 (≠ C43), N325 (= N325), D471 (= D471), A472 (= A472)
- binding coenzyme a: A11 (= A11), A18 (= A18), R19 (= R19), R22 (= R22), S39 (= S39), N42 (= N42), S43 (≠ C43), A321 (= A321), N325 (= N325), R329 (= R329), Q459 (= Q459), F462 (= F462), V463 (= V463), N466 (= N466), G534 (= G534), L535 (= L535)
- binding flavin-adenine dinucleotide: I7 (= I7), G8 (= G8), V10 (= V10), A11 (= A11), G12 (= G12), E33 (= E33), R34 (= R34), N42 (= N42), S43 (≠ C43), E80 (= E80), V81 (= V81), S112 (= S112), P113 (= P113), G114 (= G114), L133 (= L133), R134 (= R134), F161 (= F161), G302 (= G302), D303 (= D303), P319 (= P319), L320 (= L320), A321 (= A321)
3ictA Crystal structure of reduced bacillus anthracis coadr-rhd (see paper)
50% identity, 96% coverage: 19:561/566 of query aligns to 23:547/557 of 3ictA
- active site: I42 (≠ V38), N46 (= N42), C47 (= C43), N309 (= N325), S430 (= S445), F456 (≠ D471), V457 (≠ A472)
- binding coenzyme a: R23 (= R19), R26 (= R22), S43 (= S39), N46 (= N42), C47 (= C43), N309 (= N325), R313 (= R329), K439 (= K454), N451 (= N466), G520 (= G534), M521 (≠ L535), Y524 (≠ N538)
- binding flavin-adenine dinucleotide: E37 (= E33), R38 (= R34), N46 (= N42), C47 (= C43), V85 (= V81), S116 (= S112), P117 (= P113), G118 (= G114), L138 (= L133), G286 (= G302), D287 (= D303), P303 (= P319), L304 (= L320), A305 (= A321)
Sites not aligning to the query:
3icsB Crystal structure of partially reduced bacillus anthracis coadr-rhd (see paper)
50% identity, 96% coverage: 19:561/566 of query aligns to 20:544/554 of 3icsB
- active site: I39 (≠ V38), N43 (= N42), C44 (= C43), N306 (= N325), S427 (= S445), F453 (≠ D471), V454 (≠ A472)
- binding adenosine-5'-diphosphate: G162 (= G160), I164 (= I162), E183 (= E181), M184 (≠ L182), P190 (≠ T188), I244 (= I263), G245 (= G264)
- binding coenzyme a: R20 (= R19), R23 (= R22), S40 (= S39), N43 (= N42), C44 (= C43), N306 (= N325), R310 (= R329), Y428 (= Y446), K436 (= K454), M441 (≠ Q459), Y444 (≠ F462), A445 (≠ V463), N448 (= N466), G517 (= G534), M518 (≠ L535), Y521 (≠ N538)
- binding flavin-adenine dinucleotide: E34 (= E33), R35 (= R34), N43 (= N42), C44 (= C43), V82 (= V81), S113 (= S112), P114 (= P113), G115 (= G114), L135 (= L133), R136 (= R134), I164 (= I162), L252 (= L271), G283 (= G302), D284 (= D303), P300 (= P319), L301 (= L320), A302 (= A321), A305 (= A324)
Sites not aligning to the query:
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
45% identity, 99% coverage: 3:563/566 of query aligns to 2:534/539 of 8a56B
- binding flavin-adenine dinucleotide: I6 (= I7), G7 (= G8), V9 (= V10), G11 (= G12), E32 (= E33), K33 (≠ R34), C42 (= C43), V80 (= V81), S109 (= S112), P110 (= P113), G111 (= G114), I159 (= I162), G278 (= G302), D279 (= D303), S295 (≠ P319), L296 (= L320), A297 (= A321), Y422 (= Y446), A423 (= A447)
- binding 3'-phosphate-adenosine-5'-diphosphate: T17 (≠ A18), R18 (= R19), R21 (= R22), F70 (= F71), R305 (= R329), I356 (≠ V380), K430 (= K454), M435 (≠ Q459), Y438 (≠ F462), G505 (= G534), L506 (= L535), Y509 (≠ N538)
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
35% identity, 96% coverage: 18:563/566 of query aligns to 17:541/541 of 6pfzA
- active site: V37 (= V38), C42 (= C43), L455 (≠ D471), F456 (≠ A472)
- binding calcium ion: D306 (≠ G322), T332 (= T348), D427 (≠ E443), L428 (= L444)
- binding coenzyme a: R18 (= R19), R21 (= R22), S38 (= S39), G40 (≠ A41), C42 (= C43), K76 (≠ F71), R313 (= R329), Y430 (= Y446), V447 (= V463), G512 (= G534), L513 (= L535), F516 (≠ N538)
- binding flavin-adenine dinucleotide: E32 (= E33), A33 (≠ R34), R41 (≠ N42), C42 (= C43), A86 (≠ V81), A115 (≠ S112), T116 (≠ P113), G117 (= G114), L136 (= L133), G286 (= G302), D287 (= D303), P303 (= P319), F304 (≠ L320), G305 (≠ A321)
Sites not aligning to the query:
3cgeA Pyridine nucleotide complexes with bacillus anthracis coenzyme a- disulfide reductase: a structural analysis of dual NAD(p)h specificity (see paper)
34% identity, 81% coverage: 5:461/566 of query aligns to 4:440/444 of 3cgeA
- active site: A10 (= A11), Y37 (≠ V38), Q41 (≠ N42), C42 (= C43), N304 (= N325)
- binding coenzyme a: M17 (≠ A18), R21 (= R22), S38 (= S39), C42 (= C43), R61 (≠ Q62), N304 (= N325), R308 (= R329)
- binding flavin-adenine dinucleotide: I6 (= I7), D9 (≠ V10), A10 (= A11), A11 (≠ G12), L31 (≠ F32), E32 (= E33), K33 (≠ R34), Q41 (≠ N42), C42 (= C43), V80 (= V81), T112 (≠ P113), G113 (= G114), G281 (= G302), D282 (= D303), I299 (≠ L320), G300 (≠ A321), A303 (= A324), Y425 (= Y446), A426 (= A447)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I156 (≠ V157), G157 (= G158), A160 (≠ F161), I161 (= I162), E164 (= E165), E180 (= E181), R181 (≠ L182), N182 (≠ A183), T187 (= T188), V242 (≠ I263), G243 (= G264), P298 (= P319), I299 (≠ L320)
Sites not aligning to the query:
3cgdA Pyridine nucleotide complexes with bacillus anthracis coenzyme a- disulfide reductase: a structural analysis of dual NAD(p)h specificity (see paper)
34% identity, 81% coverage: 5:461/566 of query aligns to 4:440/444 of 3cgdA
- active site: A10 (= A11), Y37 (≠ V38), Q41 (≠ N42), C42 (= C43), N304 (= N325)
- binding coenzyme a: M17 (≠ A18), Q18 (≠ R19), R21 (= R22), S38 (= S39), Y39 (≠ F40), C42 (= C43), R61 (≠ Q62), N304 (= N325), R308 (= R329)
- binding flavin-adenine dinucleotide: I6 (= I7), G7 (= G8), D9 (≠ V10), A10 (= A11), A11 (≠ G12), L31 (≠ F32), E32 (= E33), K33 (≠ R34), Q41 (≠ N42), C42 (= C43), V80 (= V81), A111 (≠ S112), T112 (≠ P113), G281 (= G302), D282 (= D303), I299 (≠ L320), G300 (≠ A321), A303 (= A324), Y425 (= Y446), A426 (= A447)
- binding nicotinamide-adenine-dinucleotide: I156 (≠ V157), G157 (= G158), G159 (= G160), A160 (≠ F161), I161 (= I162), E164 (= E165), E180 (= E181), R181 (≠ L182), V242 (≠ I263), G243 (= G264), P298 (= P319), I299 (≠ L320)
Sites not aligning to the query:
3cgbA Pyridine nucleotide complexes with bacillus anthracis coenzyme a- disulfide reductase: a structural analysis of dual NAD(p)h specificity (see paper)
34% identity, 81% coverage: 5:461/566 of query aligns to 4:440/444 of 3cgbA
- active site: A10 (= A11), Y37 (≠ V38), Q41 (≠ N42), C42 (= C43), N304 (= N325)
- binding coenzyme a: D9 (≠ V10), A10 (= A11), M17 (≠ A18), R21 (= R22), S38 (= S39), Y39 (≠ F40), C42 (= C43), R61 (≠ Q62), N304 (= N325), R308 (= R329), V432 (≠ A453)
- binding flavin-adenine dinucleotide: I6 (= I7), G7 (= G8), D9 (≠ V10), A10 (= A11), A11 (≠ G12), E32 (= E33), K33 (≠ R34), Q41 (≠ N42), C42 (= C43), V80 (= V81), T112 (≠ P113), L132 (= L133), I161 (= I162), G281 (= G302), D282 (= D303), I299 (≠ L320), G300 (≠ A321), A303 (= A324), Y425 (= Y446), A426 (= A447)
Sites not aligning to the query:
O52582 Coenzyme A disulfide reductase; CoA-disulfide reductase; CoADR; EC 1.8.1.14 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see 3 papers)
34% identity, 82% coverage: 1:464/566 of query aligns to 1:437/438 of O52582
- M1 (= M1) modified: Initiator methionine, Removed
- 8:33 (vs. 8:33, 54% identical) binding
- T15 (≠ S15) binding
- Q19 (≠ R19) binding
- R22 (= R22) binding
- S39 (= S39) binding
- N42 (= N42) binding
- C43 (= C43) active site, Nucleophile; active site, Redox-active; mutation to S: Loss of activity.
- K71 (≠ F71) binding
- 267:277 (vs. 293:303, 64% identical) binding
- H299 (≠ N325) binding
- Y361 (= Y388) mutation to F: Reduces activity by 92%. Loss of activity; when associated with F-419.
- Y419 (= Y446) binding ; mutation to F: Reduces activity by 80%. Loss of activity; when associated with F-361.
- K427 (= K454) binding
4em4A Crystal structure of staphylococcus aureus bound with the covalent inhibitor pethyl-vs-coa (see paper)
33% identity, 80% coverage: 15:464/566 of query aligns to 14:436/437 of 4em4A
- active site: N41 (= N42), C42 (= C43), T135 (≠ M139), I138 (= I142), D139 (≠ L143), Y157 (≠ F161), E161 (= E165), H298 (≠ N325)
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(3R)-2,2-dimethyl-3-oxidanyl-4-oxidanylidene-4-[[3-oxidanylidene-3-[4-(phenylsulfonyl)butylamino]propyl]amino]butyl] hydrogen phosphate: T14 (≠ S15), S17 (≠ A18), Q18 (≠ R19), R21 (= R22), S38 (= S39), F39 (= F40), A40 (= A41), N41 (= N42), C42 (= C43), K70 (≠ F71), A294 (= A321), H298 (≠ N325), Y360 (= Y388), Y418 (= Y446), P425 (≠ A453), M431 (≠ Q459)
- binding flavin-adenine dinucleotide: F31 (= F32), E32 (= E33), K33 (≠ R34), N41 (= N42), C42 (= C43), V80 (= V81), S111 (= S112), P112 (= P113), G113 (= G114), R130 (= R134), Y157 (≠ F161), F244 (≠ L271), G275 (= G302), D276 (= D303), P292 (= P319), L293 (= L320), A294 (= A321), Y418 (= Y446), A419 (= A447)
Sites not aligning to the query:
4em3A Crystal structure of staphylococcus aureus bound with the covalent inhibitor mevs-coa (see paper)
33% identity, 80% coverage: 15:464/566 of query aligns to 14:436/437 of 4em3A
- active site: N41 (= N42), C42 (= C43), T135 (≠ M139), I138 (= I142), D139 (≠ L143), Y157 (≠ F161), E161 (= E165), H298 (≠ N325)
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(3R)-2,2-dimethyl-4-[[3-(4-methylsulfonylbutylamino)-3-oxidanylidene-propyl]amino]-3-oxidanyl-4-oxidanylidene-butyl] hydrogen phosphate: T14 (≠ S15), S17 (≠ A18), Q18 (≠ R19), R21 (= R22), S38 (= S39), F39 (= F40), A40 (= A41), N41 (= N42), C42 (= C43), H298 (≠ N325), Y360 (= Y388), Y418 (= Y446), K426 (= K454), M431 (≠ Q459), Y434 (≠ F462)
- binding flavin-adenine dinucleotide: F31 (= F32), E32 (= E33), K33 (≠ R34), N41 (= N42), C42 (= C43), V80 (= V81), S111 (= S112), P112 (= P113), G113 (= G114), R130 (= R134), Y157 (≠ F161), G275 (= G302), D276 (= D303), P292 (= P319), L293 (= L320), A294 (= A321), Y418 (= Y446), A419 (= A447)
Sites not aligning to the query:
1yqzA Structure of coenzyme a-disulfide reductase from staphylococcus aureus refined at 1.54 angstrom resolution (see paper)
33% identity, 80% coverage: 15:464/566 of query aligns to 14:436/437 of 1yqzA
- active site: N41 (= N42), C42 (= C43), T135 (≠ M139), I138 (= I142), D139 (≠ L143), Y157 (≠ F161), E161 (= E165), H298 (≠ N325)
- binding chloride ion: A40 (= A41), C42 (= C43), N84 (≠ D85), E86 (≠ A87)
- binding coenzyme a: T14 (≠ S15), S17 (≠ A18), Q18 (≠ R19), R21 (= R22), S38 (= S39), F39 (= F40), N41 (= N42), C42 (= C43), Y61 (≠ Q62), A294 (= A321), H298 (≠ N325), P425 (≠ A453), K426 (= K454), M431 (≠ Q459)
- binding flavin-adenine dinucleotide: F31 (= F32), E32 (= E33), K33 (≠ R34), N41 (= N42), C42 (= C43), V80 (= V81), S111 (= S112), P112 (= P113), G113 (= G114), R130 (= R134), Y157 (≠ F161), V158 (≠ I162), F244 (≠ L271), G275 (= G302), D276 (= D303), P292 (= P319), L293 (= L320), A294 (= A321), Y418 (= Y446), A419 (= A447)
Sites not aligning to the query:
4emwA Crystal structure of staphylococcus aureus bound with the covalent inhibitor etvc-coa (see paper)
33% identity, 80% coverage: 15:464/566 of query aligns to 14:436/436 of 4emwA
- active site: N41 (= N42), C42 (= C43), T135 (≠ M139), I138 (= I142), D139 (≠ L143), Y157 (≠ F161), E161 (= E165), H298 (≠ N325)
- binding ethyl 5-[3-[[(2R)-4-[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]pentanoate: T14 (≠ S15), S17 (≠ A18), Q18 (≠ R19), R21 (= R22), S38 (= S39), A40 (= A41), N41 (= N42), C42 (= C43), Y61 (≠ Q62), K70 (≠ F71), A294 (= A321), H298 (≠ N325), Y418 (= Y446), K426 (= K454), M431 (≠ Q459)
- binding flavin-adenine dinucleotide: E32 (= E33), K33 (≠ R34), N41 (= N42), C42 (= C43), P45 (= P46), V80 (= V81), S111 (= S112), P112 (= P113), G113 (= G114), R130 (= R134), Y157 (≠ F161), F244 (≠ L271), G275 (= G302), D276 (= D303), P292 (= P319), L293 (= L320), A294 (= A321), Y418 (= Y446), A419 (= A447)
Sites not aligning to the query:
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
32% identity, 77% coverage: 28:461/566 of query aligns to 29:439/443 of 6rvhA
- active site: V39 (= V38), C44 (= C43), E53 (= E52), E58 (≠ S57), Y159 (≠ F161), E163 (= E165), A425 (= A447), P430 (≠ S452)
- binding coenzyme a: S40 (= S39), Y41 (≠ F40), C44 (= C43), R63 (≠ Q62), N303 (= N325), R307 (= R329), Q359 (≠ H381), V431 (≠ A453), I437 (≠ Q459)
- binding flavin-adenine dinucleotide: E34 (= E33), K35 (≠ R34), A43 (≠ N42), C44 (= C43), V81 (= V81), T113 (≠ P113), G114 (= G114), R134 (= R134), Y159 (≠ F161), G280 (= G302), D281 (= D303), P297 (= P319), L298 (= L320), G299 (≠ A321), Y424 (= Y446), A425 (= A447)
- binding menadione: A364 (= A386), H365 (≠ S387), P430 (≠ S452), V431 (≠ A453)
Sites not aligning to the query:
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
32% identity, 77% coverage: 28:461/566 of query aligns to 29:439/443 of 6rvbA
- active site: V39 (= V38), C44 (= C43), E53 (= E52), E58 (≠ S57), Y159 (≠ F161), E163 (= E165), A425 (= A447), P430 (≠ S452)
- binding coenzyme a: S40 (= S39), Y41 (≠ F40), C44 (= C43), R63 (≠ Q62), N303 (= N325), R307 (= R329), Q359 (≠ H381), I437 (≠ Q459)
- binding flavin-adenine dinucleotide: Y33 (≠ F32), E34 (= E33), K35 (≠ R34), S36 (≠ G35), A43 (≠ N42), C44 (= C43), E80 (= E80), V81 (= V81), T113 (≠ P113), G114 (= G114), L133 (= L133), R134 (= R134), I160 (= I162), G280 (= G302), D281 (= D303), L298 (= L320), G299 (≠ A321), Y424 (= Y446), A425 (= A447)
- binding nicotinamide-adenine-dinucleotide: G156 (= G158), G158 (= G160), Y159 (≠ F161), I160 (= I162), E179 (= E181), A180 (≠ L182), A240 (= A262), T241 (≠ I263), G242 (= G264), P297 (= P319), I328 (= I350), F329 (≠ C351)
Sites not aligning to the query:
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
32% identity, 77% coverage: 28:461/566 of query aligns to 29:439/443 of 6ruzA
- active site: V39 (= V38), C44 (= C43), E53 (= E52), E58 (≠ S57), Y159 (≠ F161), E163 (= E165), A425 (= A447), P430 (≠ S452)
- binding coenzyme a: S40 (= S39), Y41 (≠ F40), C44 (= C43), R63 (≠ Q62), N303 (= N325), R307 (= R329), Q359 (≠ H381)
- binding flavin-adenine dinucleotide: Y33 (≠ F32), E34 (= E33), K35 (≠ R34), A43 (≠ N42), C44 (= C43), E80 (= E80), V81 (= V81), T113 (≠ P113), G114 (= G114), A115 (= A115), L133 (= L133), R134 (= R134), Y159 (≠ F161), G280 (= G302), D281 (= D303), P297 (= P319), L298 (= L320), G299 (≠ A321), Y424 (= Y446), A425 (= A447)
Sites not aligning to the query:
4fx9B Structure of the pyrococcus horikoshii coa persulfide/polysulfide reductase (see paper)
31% identity, 80% coverage: 2:455/566 of query aligns to 3:430/443 of 4fx9B
- active site: A12 (= A11), V39 (= V38), P43 (≠ N42), C44 (= C43), S54 (≠ A54), D57 (≠ S57), Y157 (≠ F161), E161 (= E165), N301 (= N325), A420 (≠ S445), A422 (= A447), P427 (≠ S452)
- binding coenzyme a: A12 (= A11), M15 (≠ A14), S16 (= S15), R23 (= R22), S40 (= S39), H41 (≠ F40), C44 (= C43), Y61 (≠ L61), Y62 (≠ Q62), R71 (≠ F71), A297 (= A321), N301 (= N325), I356 (≠ V380), V428 (≠ A453), W429 (≠ K454)
- binding flavin-adenine dinucleotide: G11 (≠ V10), A13 (≠ G12), F33 (= F32), E34 (= E33), A35 (≠ R34), H41 (≠ F40), P43 (≠ N42), C44 (= C43), V81 (= V81), N109 (≠ P113), A129 (≠ L133), D130 (≠ R134), L131 (≠ N135), Y157 (≠ F161), I158 (= I162), G278 (= G302), D279 (= D303), P295 (= P319), L296 (= L320), A297 (= A321), Y421 (= Y446), A422 (= A447)
Sites not aligning to the query:
O58308 NAD(P)H coenzyme A polysulfide/persulfide reductase; Coenzyme A disulfide reductase; CoA-disulfide reductase; CoADR; Polysulfide reductase; EC 1.8.1.-; EC 1.8.1.14 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
31% identity, 80% coverage: 2:455/566 of query aligns to 7:434/445 of O58308
Sites not aligning to the query:
2npxA Nadh binding site and catalysis of nadh peroxidase (see paper)
28% identity, 82% coverage: 3:464/566 of query aligns to 2:442/447 of 2npxA
- active site: H10 (≠ A11), I37 (≠ V38), S41 (≠ N42), C42 (= C43), K139 (≠ R141), Q142 (= Q144), K143 (≠ T145), R303 (≠ N325), F423 (≠ S445)
- binding flavin-adenine dinucleotide: L6 (≠ I7), S9 (≠ V10), H10 (≠ A11), E32 (= E33), K33 (≠ R34), S41 (≠ N42), C42 (= C43), E78 (= E80), I79 (≠ V81), P111 (= P113), G112 (= G114), R132 (= R134), I160 (= I162), N247 (≠ E268), G280 (= G302), D281 (= D303), A297 (≠ P319), L298 (= L320), A299 (= A321)
- binding nicotinamide-adenine-dinucleotide: G158 (= G160), Y159 (≠ F161), I160 (= I162), D179 (≠ E181), I180 (≠ L182), Y188 (≠ F197), V242 (≠ I263), G243 (= G264), A297 (≠ P319)
P37062 NADH peroxidase; NPXase; Npx; EC 1.11.1.1 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
28% identity, 82% coverage: 3:464/566 of query aligns to 2:442/447 of P37062
- GSSHG 7:11 (≠ GGVAG 8:12) binding
- H10 (≠ A11) active site, Proton acceptor
- E32 (= E33) binding
- C42 (= C43) active site, Redox-active; binding ; modified: Cysteine sulfenic acid (-SOH)
- SPGA 110:113 (= SPGA 112:115) binding
- R132 (= R134) binding
- I160 (= I162) binding
- D179 (≠ E181) binding
- Y188 (≠ F197) binding
- G243 (= G264) binding
- D281 (= D303) binding
- A297 (≠ P319) binding
- A299 (= A321) binding
- G328 (≠ I350) binding
Query Sequence
>5208217 FitnessBrowser__PV4:5208217
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALV
LQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVP
PIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLL
ELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHI
KGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYA
VGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGA
TGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGID
KRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQI
DNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFCQVGLRGNVA
YRQLVNNGYRARNLIGGYRTYKFASV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory