Comparing 5208288 FitnessBrowser__PV4:5208288 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
37% identity, 89% coverage: 1:368/413 of query aligns to 1:366/501 of 2qcuB
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
37% identity, 89% coverage: 1:368/413 of query aligns to 1:366/495 of 2r46A
Sites not aligning to the query:
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
37% identity, 89% coverage: 1:368/413 of query aligns to 1:366/495 of 2r45A
Sites not aligning to the query:
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 88% coverage: 4:368/413 of query aligns to 74:450/629 of Q9SS48
Sites not aligning to the query:
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
30% identity, 99% coverage: 1:408/413 of query aligns to 14:429/530 of 2rgoB
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
30% identity, 90% coverage: 2:372/413 of query aligns to 17:398/557 of 2rgoA
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
28% identity, 88% coverage: 2:365/413 of query aligns to 17:329/496 of 3da1A
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
27% identity, 58% coverage: 4:244/413 of query aligns to 3:240/366 of 3dmeA
Sites not aligning to the query:
Q9HUH4 Probable FAD-dependent oxidoreductase PA4991; EC 1.-.-.- from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
34% identity, 16% coverage: 3:70/413 of query aligns to 6:73/391 of Q9HUH4
Sites not aligning to the query:
5ez7A Crystal structure of the fad dependent oxidoreductase pa4991 from pseudomonas aeruginosa (see paper)
40% identity, 12% coverage: 3:52/413 of query aligns to 6:55/363 of 5ez7A
Sites not aligning to the query:
>5208288 FitnessBrowser__PV4:5208288
MQAVDLVVIGGGITGVGIAQCVQAAGYSVVLLEKDNLGEKTSSNSSKLIHGGLRYLESGQ
LGLVRQSLSERKALLTLAPELVKPVPFYIPIYRGSQRGPLAIRAGLSLYALLSELDPLGQ
FQSVPASRWSELAGLKLKGLRAVFRYWDAQTDDGALTRAVAQSARALGAELLTQVSLEQI
EHRPDSCIVSFSHKGETRRLSSRCVINATGPWVNQTLERVTPKVEVSPVELVQGSHLVLD
IPAPSGIFYLESIFDKRVVFVMPWQGKTMIGTTETPIDAVDAAGVTPAEEAYLLGIYRHY
FPLSENDGALEERITGRYCGVRVLPKQGGEAFDLPRDTMMLSRDTHPNLLTVYGGKLTTF
RHTAKEALAWVKNRRGPKPIRADVDKLRLTPVTDEAPSSESPTAKGDFSPQKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory