SitesBLAST
Comparing 5208388 FitnessBrowser__PV4:5208388 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2r0nA The effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate (see paper)
71% identity, 99% coverage: 5:390/391 of query aligns to 1:388/390 of 2r0nA
- active site: L133 (= L138), T134 (= T139), A247 (= A249), E368 (= E370), R380 (= R382)
- binding flavin-adenine dinucleotide: F131 (= F136), L133 (= L138), T134 (= T139), G139 (= G144), S140 (= S145), W166 (= W169), I167 (= I170), T168 (= T171), Y367 (= Y369), T370 (= T372), D372 (= D374)
- binding 3-thiaglutaryl-CoA: R92 (= R97), S93 (= S98), V97 (= V102), P142 (= P147), G238 (≠ K240), F241 (= F243), L244 (= L246), N245 (= N247), P318 (≠ V320), Y367 (= Y369), E368 (= E370), I377 (= I379)
1sirA The crystal structure and mechanism of human glutaryl-coa dehydrogenase (see paper)
71% identity, 99% coverage: 5:390/391 of query aligns to 1:388/390 of 1sirA
- active site: L133 (= L138), T134 (= T139), A247 (= A249), E368 (= E370), R380 (= R382)
- binding flavin-adenine dinucleotide: F131 (= F136), L133 (= L138), T134 (= T139), G139 (= G144), S140 (= S145), W166 (= W169), I167 (= I170), T168 (= T171), Y367 (= Y369), T370 (= T372)
- binding s-4-nitrobutyryl-coa: S93 (= S98), S140 (= S145), F241 (= F243), G242 (= G244), L244 (= L246), N245 (= N247), R248 (= R250), P318 (≠ V320), Y367 (= Y369), E368 (= E370), R380 (= R382)
2r0mA The effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate (see paper)
71% identity, 99% coverage: 5:390/391 of query aligns to 1:388/390 of 2r0mA
- active site: L133 (= L138), T134 (= T139), A247 (= A249), D368 (≠ E370), R380 (= R382)
- binding 4-nitrobutanoic acid: L101 (= L106), Y367 (= Y369), D368 (≠ E370)
- binding flavin-adenine dinucleotide: F131 (= F136), L133 (= L138), T134 (= T139), G139 (= G144), S140 (= S145), W166 (= W169), I167 (= I170), T168 (= T171), L210 (= L212), Y367 (= Y369), T370 (= T372)
3gqtC Crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment (1,4-dimethyl-1,2,3,4- tetrahydroquinoxalin-6-yl)methylamine (see paper)
69% identity, 98% coverage: 6:390/391 of query aligns to 3:385/385 of 3gqtC
- active site: L135 (= L138), T136 (= T139), A250 (= A249), E365 (= E370), R377 (= R382)
- binding 1-(1,4-dimethyl-1,2,3,4-tetrahydroquinoxalin-6-yl)methanamine: W166 (= W169), K210 (= K209), L213 (= L212), T218 (= T217), Y364 (= Y369)
3eonC 2.55a crystal structure of native glutaryl-coa dehydrogenase from burkholderia pseudomallei in complex with a small molecule (see paper)
69% identity, 98% coverage: 6:389/391 of query aligns to 3:382/382 of 3eonC
3gncA Crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment 6421 (see paper)
69% identity, 98% coverage: 6:389/391 of query aligns to 4:380/380 of 3gncA
3d6bC 2.2 a crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei (see paper)
68% identity, 98% coverage: 6:389/391 of query aligns to 3:377/377 of 3d6bC
3sf6A Crystal structure of glutaryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
48% identity, 97% coverage: 10:390/391 of query aligns to 6:386/387 of 3sf6A
- active site: L134 (= L138), T135 (= T139), A245 (= A249), E366 (= E370), Q378 (≠ R382)
- binding dihydroflavine-adenine dinucleotide: F132 (= F136), L134 (= L138), T135 (= T139), G140 (= G144), S141 (= S145), W165 (= W169), I166 (= I170), T167 (= T171), S361 (≠ A365), T364 (= T368), Y365 (= Y369), T368 (= T372), E370 (≠ D374), M371 (≠ I375)
2ebaA Crystal structure of the putative glutaryl-coa dehydrogenase from thermus thermophilus
48% identity, 97% coverage: 10:390/391 of query aligns to 3:380/380 of 2ebaA
- active site: L131 (= L138), T132 (= T139), A239 (= A249), E360 (= E370), R372 (= R382)
- binding flavin-adenine dinucleotide: L131 (= L138), T132 (= T139), G136 (≠ V143), G137 (= G144), S138 (= S145), W161 (= W169), T163 (= T171), R265 (= R275), L272 (= L282), K275 (≠ T285), D333 (= D343), I334 (≠ M344), G337 (= G347), T355 (≠ A365), T358 (= T368), Y359 (= Y369), T362 (= T372)
3swoA Crystal structure of a glutaryl-coa dehydrogenase from mycobacterium smegmatis in complex with fadh2 (see paper)
47% identity, 97% coverage: 11:390/391 of query aligns to 6:387/388 of 3swoA
- active site: L135 (= L138), T136 (= T139), A246 (= A249), E367 (= E370), K379 (≠ R382)
- binding dihydroflavine-adenine dinucleotide: F133 (= F136), L135 (= L138), T136 (= T139), G141 (= G144), S142 (= S145), W166 (= W169), I167 (= I170), T168 (= T171), R272 (= R275), V274 (≠ Q277), F275 (= F278), L279 (= L282), Y282 (≠ T285), T340 (≠ D343), L341 (≠ M344), G344 (= G347), I347 (= I350), T365 (= T368), Y366 (= Y369), T369 (= T372), E371 (≠ D374), M372 (≠ I375)
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
37% identity, 94% coverage: 15:383/391 of query aligns to 2:376/380 of 4l1fA
- active site: L125 (= L138), T126 (= T139), G242 (≠ A249), E363 (= E370), R375 (= R382)
- binding coenzyme a persulfide: T132 (≠ S145), H179 (vs. gap), F232 (≠ L239), M236 (≠ F243), E237 (≠ G244), L239 (= L246), D240 (≠ N247), R243 (= R250), Y362 (= Y369), E363 (= E370), G364 (= G371), R375 (= R382)
- binding flavin-adenine dinucleotide: F123 (= F136), L125 (= L138), T126 (= T139), G131 (= G144), T132 (≠ S145), F156 (≠ W169), I157 (= I170), T158 (= T171), R268 (= R275), Q270 (= Q277), F271 (= F278), I275 (≠ L282), F278 (≠ T285), L281 (≠ I288), Q336 (≠ D343), I337 (≠ M344), G340 (= G347), I358 (≠ A365), Y362 (= Y369), T365 (= T372), Q367 (≠ D374)
- binding 1,3-propandiol: L5 (= L18), Q10 (≠ R23)
2ix6A Short chain specific acyl-coa oxidase from arabidopsis thaliana, acx4 (see paper)
35% identity, 97% coverage: 10:390/391 of query aligns to 31:412/416 of 2ix6A
- active site: L158 (= L138), T159 (= T139), S271 (≠ A249), E392 (= E370), R404 (= R382)
- binding flavin-adenine dinucleotide: T159 (= T139), G164 (= G144), S165 (= S145), W189 (= W169), N239 (≠ T217), R297 (= R275), F300 (= F278), L304 (= L282), F307 (≠ T285), N310 (≠ I288), E365 (≠ D343), L366 (≠ M344), G369 (= G347), I372 (= I350), Y391 (= Y369), T394 (= T372), D396 (= D374)
2ix5A Short chain specific acyl-coa oxidase from arabidopsis thaliana, acx4 in complex with acetoacetyl-coa (see paper)
35% identity, 97% coverage: 10:390/391 of query aligns to 31:412/415 of 2ix5A
- active site: L158 (= L138), T159 (= T139), S271 (≠ A249), E392 (= E370), R404 (= R382)
- binding acetoacetyl-coenzyme a: S165 (= S145), A167 (≠ P147), S168 (≠ G148), F261 (≠ L239), L268 (= L246), R272 (= R250), E392 (= E370), G393 (= G371), R404 (= R382)
- binding flavin-adenine dinucleotide: L158 (= L138), T159 (= T139), G164 (= G144), S165 (= S145), W189 (= W169), N239 (≠ T217), R297 (= R275), F300 (= F278), L304 (= L282), F307 (≠ T285), L309 (= L287), N310 (≠ I288), E365 (≠ D343), L366 (≠ M344), G368 (= G346), G369 (= G347), Y391 (= Y369), T394 (= T372), D396 (= D374), I397 (= I375)
Q96329 Acyl-coenzyme A oxidase 4, peroxisomal; AOX 4; G6p; Short-chain acyl-CoA oxidase; AtCX4; AtG6; SAOX; EC 1.3.3.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 97% coverage: 10:390/391 of query aligns to 47:428/436 of Q96329
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
36% identity, 93% coverage: 20:382/391 of query aligns to 4:370/374 of 5lnxD
- active site: L122 (= L138), T123 (= T139), G239 (≠ A249), E358 (= E370), K370 (≠ R382)
- binding flavin-adenine dinucleotide: L122 (= L138), T123 (= T139), G128 (= G144), S129 (= S145), F153 (≠ W169), T155 (= T171), R265 (= R275), Q267 (= Q277), F268 (= F278), I272 (≠ L282), N275 (≠ T285), I278 (= I288), Q331 (≠ D343), I332 (≠ M344), G335 (= G347), Y357 (= Y369), T360 (= T372), E362 (≠ D374)
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
35% identity, 95% coverage: 13:382/391 of query aligns to 1:376/378 of 4n5fA
- active site: L126 (= L138), T127 (= T139), G243 (≠ A249), E364 (= E370), R376 (= R382)
- binding dihydroflavine-adenine dinucleotide: L126 (= L138), T127 (= T139), G132 (= G144), S133 (= S145), F157 (≠ W169), T159 (= T171), T210 (= T217), Y363 (= Y369), T366 (= T372), E368 (≠ D374), M372 (≠ L378)
1bucA Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
34% identity, 94% coverage: 15:383/391 of query aligns to 2:380/383 of 1bucA
- active site: L128 (= L138), T129 (= T139), G246 (≠ A249), E367 (= E370), G379 (≠ R382)
- binding acetoacetyl-coenzyme a: L96 (= L106), F126 (= F136), G134 (= G144), T135 (≠ S145), T162 (= T171), N182 (vs. gap), H183 (vs. gap), F236 (≠ L239), M240 (≠ F243), M241 (≠ G244), L243 (= L246), D244 (≠ N247), T317 (≠ P319), Y366 (= Y369), E367 (= E370), G368 (= G371)
- binding flavin-adenine dinucleotide: F126 (= F136), L128 (= L138), T129 (= T139), G134 (= G144), T135 (≠ S145), F160 (≠ W169), T162 (= T171), Y366 (= Y369), T369 (= T372), E371 (≠ D374), M375 (≠ L378)
Q06319 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; BCAD; SCAD; EC 1.3.8.1 from Megasphaera elsdenii (see paper)
34% identity, 94% coverage: 15:383/391 of query aligns to 2:380/383 of Q06319
- E367 (= E370) active site, Proton acceptor; mutation to Q: Loss of activity.
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
33% identity, 93% coverage: 17:380/391 of query aligns to 3:372/378 of 5ol2F
- active site: L124 (= L138), T125 (= T139), G241 (≠ A249)
- binding calcium ion: E29 (≠ M43), E33 (≠ N47), R35 (≠ H49)
- binding coenzyme a persulfide: L238 (= L246), R242 (= R250), E362 (= E370), G363 (= G371)
- binding flavin-adenine dinucleotide: F122 (= F136), L124 (= L138), T125 (= T139), P127 (= P141), T131 (≠ S145), F155 (≠ W169), I156 (= I170), T157 (= T171), E198 (= E207), R267 (= R275), F270 (= F278), L274 (= L282), F277 (≠ T285), Q335 (≠ D343), L336 (≠ M344), G338 (= G346), G339 (= G347), Y361 (= Y369), T364 (= T372), E366 (≠ D374)
Sites not aligning to the query:
2dvlA Crystal structure of project tt0160 from thermus thermophilus hb8
34% identity, 93% coverage: 18:382/391 of query aligns to 1:366/370 of 2dvlA
- active site: L121 (= L138), T122 (= T139), G233 (≠ A249), E354 (= E370), R366 (= R382)
- binding flavin-adenine dinucleotide: L121 (= L138), T122 (= T139), G127 (= G144), S128 (= S145), W152 (= W169), I153 (= I170), T154 (= T171), T356 (= T372), E358 (≠ D374)
Query Sequence
>5208388 FitnessBrowser__PV4:5208388
MARVKFDWQDPLQFDALLSEDERMIRDMVHDYAQEKLMTRVLMANRNEHFDREIMNELGE
LGLLGATLPEAYGCANANYVSYGLVAREIERVDSGYRSAMSVQSSLVMHPIYAYGNEQQR
QKYLPKLATGEWVGCFGLTEPDVGSDPGGMKTRAERIDGGYRLNGAKMWITNSPIADVFV
VWAKLDGVIRGFILEKGMKGLSAPKIEGKFSLRASITGEIVMDNVEVGEEALLPNVEGLK
GPFGCLNKARYGIAWGALGAAEFCWHAARQYSLDRIQFNRPLAATQLIQKKLADMQTEIT
TGLFACLQAGRLMDQDALPVEAISLIKRNSCGKALEIARTSRDMHGGNGISDEFHVIRHV
MNLEAVNTYEGTHDIHALILGRAQTGIQAFG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory