Comparing 5208389 FitnessBrowser__PV4:5208389 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
36% identity, 44% coverage: 399:731/763 of query aligns to 4:318/324 of Q5SLR3
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
36% identity, 44% coverage: 399:731/763 of query aligns to 3:317/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
36% identity, 44% coverage: 399:731/763 of query aligns to 3:317/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
36% identity, 44% coverage: 399:731/763 of query aligns to 3:317/323 of 1umbD
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
34% identity, 41% coverage: 418:731/763 of query aligns to 22:318/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
34% identity, 41% coverage: 418:731/763 of query aligns to 22:318/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
34% identity, 41% coverage: 418:731/763 of query aligns to 22:318/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
34% identity, 41% coverage: 418:731/763 of query aligns to 22:318/324 of 1w85B
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
33% identity, 44% coverage: 399:737/763 of query aligns to 5:337/338 of 1qs0B
P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 2 papers)
30% identity, 41% coverage: 399:712/763 of query aligns to 71:368/392 of P21953
2j9fD Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
30% identity, 41% coverage: 399:712/763 of query aligns to 8:305/329 of 2j9fD
1dtwB Human branched-chain alpha-keto acid dehydrogenase (see paper)
30% identity, 41% coverage: 399:712/763 of query aligns to 5:302/326 of 1dtwB
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
27% identity, 41% coverage: 405:715/763 of query aligns to 39:336/359 of P11177
Sites not aligning to the query:
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
27% identity, 41% coverage: 405:715/763 of query aligns to 10:307/330 of 6cfoB
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
27% identity, 41% coverage: 405:715/763 of query aligns to 11:308/331 of 6cerD
Q5SLR4 2-oxoisovalerate dehydrogenase subunit alpha; Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; BCKDH E1-alpha; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
29% identity, 36% coverage: 43:313/763 of query aligns to 41:297/367 of Q5SLR4
1umdA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
29% identity, 36% coverage: 43:313/763 of query aligns to 36:292/362 of 1umdA
1umcA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
29% identity, 36% coverage: 43:313/763 of query aligns to 36:292/362 of 1umcA
1umbA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
29% identity, 36% coverage: 43:313/763 of query aligns to 36:292/362 of 1umbA
P26284 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Rattus norvegicus (Rat) (see paper)
22% identity, 46% coverage: 4:354/763 of query aligns to 28:358/390 of P26284
>5208389 FitnessBrowser__PV4:5208389
MEDRAIALDRQFVERVSQQDFLEIEQGWCHTRLGLSDADFVGIFESQMKSRLLDLESRKM
RARNQGFYTIGSSGHEGNAACAAALRPTDMAFLHYRSAAFMIERARQVPGETSLWDMLLS
FAASSEDPISGGRHKVLGSKRLMIPPQTSTIASHLPKAVGAALSIPLTHRLDIDSALPED
SLVFCNFGDASANHASAQTAINAAGWAAYQQVPLPLLFVCEDNGIGISTATPNGWIAANF
KDRAGIKYFYCDGRDLLDCYRVSRQAAEYARVKRKPVFLHVRTVRLMGHAGSDAEIAYLS
KQKIFDNEAQDPLLLSAKQIIEAKLMSPDEIINQYQTLKARIAAIAMVAVERPKLTSAKA
AMAAVIPPVNDKPLTHHNLTDEAFAQLFSADKNSLGKPLHMGKLINMTLTELMARQQNIV
VCGEDVGKKGGVYHVTSRLVERFGPNRVINTLLDETSILGLAIGMAHNGLLPIPEIQFLA
YVHNAEDQIRGEAATLPFFSNGQFSNPMVIRIAGLGYQKGFGGHFHNDNSLAVFRDIPGL
ILACPSNGADAMGMLRECVRLAEQEQRLVIFLEPIALYMTRDLHEEGDGLWSHDYCPQEK
AKALPYGELGVYGKGKTLAILSYGNGYYLSRQAERELSKLGIDCRVIDLRYLIPLNEEAI
IAAVSECEHLLIVDECRRSGSVSEAIVTCVHERLGDLAPQMARLTAEDCFIPLAEAATLP
LPSRSQIVEAALALVGEQALVGEHAVDDEGSETIQDAGVRQVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory