Comparing 5208459 FitnessBrowser__PV4:5208459 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
60% identity, 97% coverage: 6:251/253 of query aligns to 9:255/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
60% identity, 97% coverage: 6:251/253 of query aligns to 3:249/249 of 7d53A
7d4rB Spua native structure (see paper)
52% identity, 96% coverage: 6:248/253 of query aligns to 1:214/215 of 7d4rB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
43% identity, 97% coverage: 8:253/253 of query aligns to 9:253/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
43% identity, 97% coverage: 8:253/253 of query aligns to 7:251/252 of 6vtvB
3fijA Crystal structure of a uncharacterized protein lin1909
33% identity, 86% coverage: 23:240/253 of query aligns to 5:216/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 92% coverage: 8:241/253 of query aligns to 67:296/308 of O33341
1vcnA Crystal structure of t.Th. Hb8 ctp synthetase complex with sulfate anion (see paper)
31% identity, 49% coverage: 103:226/253 of query aligns to 353:485/506 of 1vcnA
Sites not aligning to the query:
1vcoA Crystal structure of t.Th. Hb8 ctp synthetase complex with glutamine (see paper)
39% identity, 27% coverage: 158:226/253 of query aligns to 430:509/531 of 1vcoA
Sites not aligning to the query:
Q5SIA8 CTP synthase; Cytidine 5'-triphosphate synthase; Cytidine triphosphate synthetase; CTP synthetase; CTPS; UTP--ammonia ligase; EC 6.3.4.2 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
39% identity, 27% coverage: 158:226/253 of query aligns to 447:526/550 of Q5SIA8
Sites not aligning to the query:
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
32% identity, 51% coverage: 102:230/253 of query aligns to 92:198/693 of P49915
Sites not aligning to the query:
>5208459 FitnessBrowser__PV4:5208459
MSDEGLAVIGVTACNQQIGLHPFNIVGEKYLLGIADATQGWPLVIPALGHCPAETILPRL
DGLLFTGSPSNIEPHHYDGVASDPDTLHDPKRDATNLPLLKAAIDAGVPVLAICRGFQEM
NVVYGGSLHQKLHEVGDYIEHREDKTADVEVQYGLSHPLKIEPGGLLHEAWGRNLAEVNS
VHTQGVDRLGVGLRPEAYAPDGLIEAFSVKDAKNFALGVQFHPEWKVLENPFYRSIFSAF
SQACQARAAQRKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory