Comparing 5208470 FitnessBrowser__PV4:5208470 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
32% identity, 98% coverage: 8:504/508 of query aligns to 13:489/503 of Q8C165
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
27% identity, 54% coverage: 109:380/508 of query aligns to 62:278/407 of P37111
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
27% identity, 54% coverage: 109:380/508 of query aligns to 62:279/408 of Q03154
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
38% identity, 23% coverage: 111:225/508 of query aligns to 58:169/192 of 1q7lA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
28% identity, 32% coverage: 105:268/508 of query aligns to 48:202/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
28% identity, 32% coverage: 105:268/508 of query aligns to 44:198/377 of P44514
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
32% identity, 22% coverage: 105:214/508 of query aligns to 46:154/258 of 4h2kA
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
26% identity, 31% coverage: 109:268/508 of query aligns to 53:199/377 of 7lgpB
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
26% identity, 31% coverage: 112:268/508 of query aligns to 52:198/377 of 7t1qA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
28% identity, 31% coverage: 112:268/508 of query aligns to 52:198/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
28% identity, 31% coverage: 112:268/508 of query aligns to 52:198/375 of 4pqaA
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
30% identity, 20% coverage: 105:207/508 of query aligns to 70:169/458 of 2pokA
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
35% identity, 17% coverage: 114:199/508 of query aligns to 86:169/475 of Q96KP4
Sites not aligning to the query:
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
35% identity, 17% coverage: 114:199/508 of query aligns to 90:173/478 of 2zogA
Sites not aligning to the query:
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
35% identity, 17% coverage: 114:199/508 of query aligns to 90:173/478 of 2zofA
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
35% identity, 17% coverage: 114:199/508 of query aligns to 86:169/475 of Q9D1A2
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
32% identity, 20% coverage: 112:214/508 of query aligns to 52:152/265 of 4op4B
Sites not aligning to the query:
7rsfA Acetylornithine deacetylase from escherichia coli
26% identity, 36% coverage: 123:303/508 of query aligns to 73:226/380 of 7rsfA
4mmoA The crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus
29% identity, 32% coverage: 123:284/508 of query aligns to 67:218/437 of 4mmoA
>5208470 FitnessBrowser__PV4:5208470
MAKCFKYGVIVSQIALIGLSFSIQAKENNDFSSMQMKGVEQVSVKVDLDPAVERLSKAVQ
FRTISNQDRNDFDEKAFTDYHQFLEKAYPNVHKTLKREVLGSPRPFSLLYTWKGKDPSLP
PALFYAHQDVVPVPSESRDQWAVDPFAGAVQDGYIWGRGVLDDKNQIHGILEAAEMKIKE
GWQPSRTLYFVFGQDEEVGGPEGAKYIADVLEQRGIKRFAFVIDESAPLTPGIFPGIPDN
TALIGIAQKGFVSLELAMNGIGGHSSQPPEESNIGILAKAITKLEAAQFPYRIHEAVRHQ
YRYMGPELSEDKQPMYAAVAFGKDGEITPLEQKFIDEMASQQVTRAMLHTTIAVTMFNAG
IKDNVLPPSATAVVNFRPMPGDTPEVIIAHVKKAIGDDRITVRDISASTPATNVADPSSK
SYQQLEKTIRQIYGNDLIVSPFFVIGGSDSKHFQARKFAPDVYTITGLQLESVKEFAGFH
GVNERIRVDEYGRTIGFFYKLMDNLEEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory