SitesBLAST
Comparing 5208648 FitnessBrowser__PV4:5208648 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09242 Alkaline phosphatase, tissue-nonspecific isozyme; AP-TNAP; TNAP; TNSALP; Alkaline phosphatase 2; Alkaline phosphatase liver/bone/kidney isozyme; Phosphoamidase; Phosphocreatine phosphatase; EC 3.1.3.1; EC 3.9.1.1 from Mus musculus (Mouse) (see paper)
43% identity, 88% coverage: 53:532/545 of query aligns to 29:487/524 of P09242
- N140 (≠ S165) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N230 (≠ T257) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N303 (≠ V325) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N430 (= N466) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P15693 Intestinal-type alkaline phosphatase 1; IAP-1; Intestinal alkaline phosphatase 1; Intestinal alkaline phosphatase I; IAP-I; EC 3.1.3.1 from Rattus norvegicus (Rat) (see 2 papers)
45% identity, 85% coverage: 75:535/545 of query aligns to 52:488/540 of P15693
- D62 (= D85) binding ; binding
- S112 (= S135) active site, Phosphoserine intermediate; binding
- C141 (= C164) modified: Disulfide link with 203
- S175 (≠ T198) binding
- C203 (= C226) modified: Disulfide link with 141
- N301 (≠ G324) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E331 (= E354) binding
- D336 (= D359) binding
- H340 (= H363) binding
- D377 (= D400) binding
- H378 (= H401) binding
- N428 (≠ Y465) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- H452 (= H499) binding
- C487 (≠ D534) modified: Disulfide link with 494
Sites not aligning to the query:
- 1:20 signal peptide
- 494 modified: Disulfide link with 487
7yivA The crystal structure of human tissue nonspecific alkaline phosphatase (alpl) at basic ph (see paper)
43% identity, 84% coverage: 76:532/545 of query aligns to 34:470/484 of 7yivA
- binding calcium ion: E218 (= E262), F273 (= F309), D289 (≠ E328)
- binding magnesium ion: D43 (= D85), H154 (= H196), T156 (= T198), E315 (= E354)
- binding zinc ion: D43 (= D85), S93 (= S135), D320 (= D359), H324 (= H363), D361 (= D400), H362 (= H401), H437 (= H499)
P05186 Alkaline phosphatase, tissue-nonspecific isozyme; AP-TNAP; TNS-ALP; TNSALP; Alkaline phosphatase liver/bone/kidney isozyme; Phosphoamidase; Phosphocreatine phosphatase; EC 3.1.3.1; EC 3.9.1.1 from Homo sapiens (Human) (see 39 papers)
43% identity, 84% coverage: 76:532/545 of query aligns to 51:487/524 of P05186
- M62 (= M87) to L: in HOPS; moderate; 27% of activity
- G63 (= G88) to V: in HOPS; loss of activity
- T68 (= T93) to M: in HPPC; severe allele
- R71 (= R96) to C: in HOPS; abolished alkaline phosphatase activity; dbSNP:rs121918001; to H: in HOPS; loss of alkaline phosphatase activity; dbSNP:rs121918003; to P: in HOPS; abolished alkaline phosphatase activity; dbSNP:rs121918003; to S: in HPPC; severe allele; dbSNP:rs121918001
- G75 (= G100) to S: in HOPS; severe; 3.5% of activity; dbSNP:rs1304394441
- G82 (= G107) to R: in HOPS; dominant-negative mutant; abolished alkaline phosphatase activity
- P108 (= P133) to L: in HOPS; 0.4% of alkaline phosphatase activity; severe allele; no effect on subcellular location; fails to assemble into dimeric structure; dominant negative effect; dbSNP:rs121918015
- A111 (= A136) to T: in HOPS; odonto; abolished alkaline phosphatase activity; dbSNP:rs773257111
- A116 (= A141) to T: in HOPS; loss of alkaline phosphatase activity; dbSNP:rs121918013
- A132 (≠ E157) to V: in HOPS; strongly reduced alkaline phosphatase activity
- T134 (≠ V159) to H: in HOPS; requires 2 nucleotide substitutions; dbSNP:rs786204530; to N: in HOPS; 9% of activity; dbSNP:rs780583917
- R136 (= R161) to H: in HOPS; moderate; 33% of activity; dbSNP:rs121918011
- R152 (≠ E177) to C: in HOPS; uncertain significance; to H: in HOPS; benign; lethal form; dbSNP:rs149344982
- G162 (= G187) to V: in HOPS; severe; 1% of activity; dbSNP:rs121918012
- H171 (= H196) to Y: in HOPS; severe; 2% of activity
- A176 (= A201) to T: in HOPS; 30% of alkaline phosphatase activity; dbSNP:rs121918019
- A177 (≠ T202) to T: in HOPS and HPPC; moderate allele; normal alkaline phosphatase activity toward diphosphate and increased activity toward pyridoxal 5'-phosphate; dbSNP:rs199669988
- A179 (= A204) to T: in HOPS; reduced alkaline phosphatase activity toward diphosphate and pyridoxal 5'-phosphate; dbSNP:rs121918000
- S181 (≠ V206) to L: in HOPS; 1% of activity; dbSNP:rs199590449
- R184 (= R209) to W: in HOPS; loss of activity; dbSNP:rs763159520
- S188 (≠ A213) to P: in HOPS; uncertain significance
- E191 (≠ N216) to G: in HOPS; odonto; slightly reduced alkaline phosphatase activity; to K: in HOPS; moderate; frequent mutation in European countries; slightly reduced alkaline phosphatase activity; dbSNP:rs121918007
- C201 (= C226) to Y: in HOPS; weak alkaline phosphatase activity; severely affects homodimerization; reduced cell surface expression
- I218 (≠ V245) to S: in HOPS; uncertain significance
- G220 (= G247) to V: in HOPS; odonto
- R223 (= R250) to W: in HOPS and HPPC; severe allele; abolished alkaline phosphatase activity; dbSNP:rs766076920
- K224 (≠ R251) to E: in HPPI; partial loss of activity; dbSNP:rs1226800998
- E235 (= E262) binding ; mutation to A: Abolished alkaline phosphatase activity.
- R246 (= R268) to S: in HOPS; 4% of activity; dbSNP:rs1223142821
- G249 (= G271) to V: in HOPS; partial loss of activity; dbSNP:rs121918018
- Y263 (= Y282) to H: in dbSNP:rs3200254
- W270 (≠ T289) mutation to A: Reduced alkaline phosphatase activity.
- R272 (= R291) to H: in HOPS; 6.8% of wild-type activity; dbSNP:rs781272386; mutation to A: Reduced alkaline phosphatase activity.
- L275 (≠ F294) to P: in HPPC; severe allele; dbSNP:rs1237252052
- F290 (= F309) binding ; mutation to A: Abolished alkaline phosphatase activity.
- E291 (≠ N310) binding ; to K: in HOPS; moderate; 8% of activity; dbSNP:rs786204473; mutation to A: Reduced alkaline phosphatase activity.
- P292 (≠ S311) to T: in HOPS; 4% of wild-type activity; dbSNP:rs765458125
- D294 (≠ H313) to A: in HOPS; reduced alkaline phosphatase toward diphosphate and pyridoxal 5'-phosphate; dbSNP:rs121918002
- M295 (= M314) to T: in HOPS; 8.5% of wild-type activity; dbSNP:rs1220125702
- Y297 (= Y316) to D: in HOPS; 1.3% of wild-type activity
- E298 (≠ D317) to K: in HPPI; does not affect alkaline phosphatase activity; dbSNP:rs121918017
- D306 (≠ E328) binding ; mutation to A: Abolished alkaline phosphatase activity.
- G326 (= G348) to R: in HOPS; in a patient carrying also K-291
- F327 (= F349) to G: in HOPS; requires 2 nucleotide substitutions; to L: in HOPS and HPPI; dbSNP:rs121918010
- G334 (= G356) to D: in HOPS; abolished alkaline phosphatase activity; dbSNP:rs121918009; to R: in HOPS; weak alkaline phosphatase activity
- G339 (≠ A361) to R: in HOPS; loss of alkaline phosphatase activity
- D378 (= D400) to V: in HOPS; strongly reduced alkaline phosphatase activity; dbSNP:rs121918008
- V382 (= V404) to I: in HOPS; abolished alkaline phosphatase activity; dbSNP:rs771540767
- R391 (= R413) to C: in HOPS; moderate; 4-10% of alkaline phosphatase activity; dbSNP:rs371243939; to H: in HPPC and HOPS; severe allele; loss of alkaline phosphatase activity; dbSNP:rs1442918125
- D406 (≠ N439) to G: in HOPS; 15% of activity
- T411 (= T444) to A: in HOPS; absence of residual enzymatic activity
- L414 (≠ G447) to M: in HOPS; loss of alkaline phosphatase activity
- N417 (= N450) to S: in HOPS; very low alkaline phosphatase activity; does not affect subcellular location; fails to assemble into dimeric structure; dbSNP:rs121918014
- G420 (= G453) to A: in HOPS; very low alkaline phosphatase activity; does not affect subcellular location; to S: in HOPS; very low alkaline phosphatase activity; does not affect subcellular location
- V423 (≠ S456) to A: in HOPS; 16% alkaline of phosphatase activity
- G426 (≠ D462) to C: in HPPI; partial loss of activity
- N430 (= N466) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N440 (≠ G485) natural variant: Missing (in HOPS; uncertain significance)
- S445 (≠ A490) to P: in HOPS; severe; 2% of activity; dbSNP:rs1553415041
- R450 (≠ E495) to C: in HOPS; severe; 4% of activity; dbSNP:rs138690664
- E452 (= E497) to K: in HOPS; loss of alkaline phosphatase activity; dbSNP:rs966212736
- G456 (= G501) to R: in HPPI and HOPS; strongly reduced alkaline phosphatase activity; dbSNP:rs121918016
- V459 (= V504) to L: in HOPS; loss of alkaline phosphatase activity
- E476 (= E521) to A: in HOPS; loss of alkaline phosphatase activity
- N478 (= N523) to I: in HOPS; 9% of activity
Sites not aligning to the query:
- 1:17 signal peptide
- 28 Y → C: in HPPI; 7% of activity
- 33 A → V: in HOPS; strongly reduced alkaline phosphatase activity; dbSNP:rs121918005
- 40 A → V: in HOPS; 2% of activity; dbSNP:rs770093969
- 489 C → S: in HOPS; reduces alkaline phosphatase activity
- 490 I → F: in HOPS; odonto; partial loss of activity
- 522 V → A: in dbSNP:rs34605986
4kjgA Structure of rat intestinal alkaline phosphatase expressed in insect cell (see paper)
45% identity, 85% coverage: 75:535/545 of query aligns to 32:468/486 of 4kjgA
- active site: D42 (= D85), S92 (= S135), H153 (= H196), S155 (≠ T198), R166 (= R209), E311 (= E354), D316 (= D359), Q317 (≠ H360), H320 (= H363), D357 (= D400), H358 (= H401), H432 (= H499)
- binding 4-nitrophenyl phosphate: D91 (= D134), S92 (= S135), R166 (= R209), H432 (= H499)
- binding magnesium ion: D42 (= D85), S155 (≠ T198), E216 (= E262), F269 (= F309), E270 (≠ N310), D285 (≠ E328), E311 (= E354), S342 (≠ M385), T345 (= T388)
- binding zinc ion: D42 (= D85), S92 (= S135), D316 (= D359), H320 (= H363), D357 (= D400), H358 (= H401), H432 (= H499)
P83456 Alkaline phosphatase; AP; EC 3.1.3.1 from Gadus morhua (Atlantic cod) (see paper)
42% identity, 88% coverage: 51:532/545 of query aligns to 14:470/477 of P83456
- N124 (≠ S165) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- C165 (≠ V206) modified: Disulfide link with 185
- C185 (= C226) modified: Disulfide link with 165
- N214 (≠ T257) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N413 (≠ D475) modified: carbohydrate, N-linked (GlcNAc...) asparagine
3mk0A Refinement of placental alkaline phosphatase complexed with nitrophenyl (see paper)
43% identity, 85% coverage: 75:535/545 of query aligns to 32:468/481 of 3mk0A
- active site: D42 (= D85), S92 (= S135), H153 (= H196), S155 (≠ T198), R166 (= R209), E311 (= E354), D316 (= D359), H317 (= H360), H320 (= H363), D357 (= D400), H358 (= H401), H432 (= H499)
- binding calcium ion: E216 (= E262), F269 (= F309), E270 (≠ N310), D285 (≠ E328)
- binding magnesium ion: D42 (= D85), S155 (≠ T198), E311 (= E354)
- binding p-nitrophenol: G211 (≠ T257), P213 (≠ V259), P218 (vs. gap), Y221 (vs. gap), R250 (= R291), L253 (≠ F294), M254 (≠ L295), S257 (≠ A296), E290 (= E333), A294 (≠ K337), R297 (≠ D340)
- binding zinc ion: D42 (= D85), S92 (= S135), S92 (= S135), D316 (= D359), H320 (= H363), D357 (= D400), H358 (= H401), H432 (= H499)
1zefA Structure of alkaline phosphatase from human placenta in complex with its uncompetitive inhibitor l-phe (see paper)
43% identity, 85% coverage: 75:535/545 of query aligns to 32:468/481 of 1zefA
- active site: D42 (= D85), S92 (= S135), H153 (= H196), S155 (≠ T198), R166 (= R209), E311 (= E354), D316 (= D359), H317 (= H360), H320 (= H363), D357 (= D400), H358 (= H401), H432 (= H499)
- binding calcium ion: E216 (= E262), F269 (= F309), E270 (≠ N310), D285 (≠ E328)
- binding magnesium ion: D42 (= D85), S155 (≠ T198), E311 (= E354)
- binding phenylalanine: S92 (= S135), F107 (≠ V150), R166 (= R209), L253 (≠ F294), M254 (≠ L295), S257 (≠ A296), E290 (= E333), E293 (≠ A336), A294 (≠ K337), R297 (≠ D340), D316 (= D359), H317 (= H360), H320 (= H363), H432 (= H499)
- binding zinc ion: D42 (= D85), S92 (= S135), S92 (= S135), D316 (= D359), H320 (= H363), D357 (= D400), H358 (= H401), H432 (= H499)
1zedA Alkaline phosphatase from human placenta in complex with p- nitrophenyl-phosphonate (see paper)
43% identity, 85% coverage: 75:535/545 of query aligns to 32:468/481 of 1zedA
- active site: D42 (= D85), S92 (= S135), H153 (= H196), S155 (≠ T198), R166 (= R209), E311 (= E354), D316 (= D359), H317 (= H360), H320 (= H363), D357 (= D400), H358 (= H401), H432 (= H499)
- binding calcium ion: E216 (= E262), F269 (= F309), E270 (≠ N310), D285 (≠ E328)
- binding magnesium ion: D42 (= D85), S155 (≠ T198), E311 (= E354)
- binding methyl-phosphonic acid mono-(4-nitro-phenyl) ester: F107 (≠ V150), Q108 (≠ G151), L253 (≠ F294), M254 (≠ L295), S257 (≠ A296), E290 (= E333), E293 (≠ A336), A294 (≠ K337), R297 (≠ D340)
- binding phosphite ion: S92 (= S135), R166 (= R209), D316 (= D359), H358 (= H401), H432 (= H499)
- binding zinc ion: D42 (= D85), S92 (= S135), D316 (= D359), H320 (= H363), D357 (= D400), H358 (= H401), H432 (= H499)
2glqA X-ray structure of human alkaline phosphatase in complex with strontium (see paper)
43% identity, 85% coverage: 75:535/545 of query aligns to 32:468/479 of 2glqA
- active site: D42 (= D85), S92 (= S135), H153 (= H196), S155 (≠ T198), R166 (= R209), E311 (= E354), D316 (= D359), H317 (= H360), H320 (= H363), D357 (= D400), H358 (= H401), H432 (= H499)
- binding magnesium ion: D42 (= D85), S155 (≠ T198), E311 (= E354)
- binding strontium ion: E216 (= E262), F269 (= F309), E270 (≠ N310), D285 (≠ E328)
- binding zinc ion: D42 (= D85), S92 (= S135), S92 (= S135), D316 (= D359), H320 (= H363), D357 (= D400), H358 (= H401), H432 (= H499)
1ew2A Crystal structure of a human phosphatase (see paper)
43% identity, 85% coverage: 75:535/545 of query aligns to 32:468/479 of 1ew2A
- active site: D42 (= D85), S92 (= S135), H153 (= H196), S155 (≠ T198), R166 (= R209), E311 (= E354), D316 (= D359), H317 (= H360), H320 (= H363), D357 (= D400), H358 (= H401), H432 (= H499)
- binding magnesium ion: D42 (= D85), S155 (≠ T198), E216 (= E262), F269 (= F309), E270 (≠ N310), D285 (≠ E328), E311 (= E354)
- binding phosphate ion: D91 (= D134), S92 (= S135), R166 (= R209), D316 (= D359), H432 (= H499)
- binding zinc ion: D42 (= D85), D316 (= D359), H320 (= H363), D357 (= D400), H358 (= H401), H432 (= H499)
P05187 Alkaline phosphatase, placental type; Alkaline phosphatase Regan isozyme; Placental alkaline phosphatase 1; PLAP-1; EC 3.1.3.1 from Homo sapiens (Human) (see 11 papers)
43% identity, 85% coverage: 75:535/545 of query aligns to 54:490/535 of P05187
- D64 (= D85) binding ; binding
- I89 (≠ N110) to L: in dbSNP:rs13026692
- S114 (= S135) binding
- C143 (= C164) modified: Disulfide link with 205
- N144 (≠ S165) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- S177 (≠ T198) binding
- C205 (= C226) modified: Disulfide link with 143
- R231 (≠ P255) to P: in dbSNP:rs1048988
- R263 (≠ Y282) to H: in dbSNP:rs2853378
- N271 (≠ D290) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E333 (= E354) binding
- D338 (= D359) binding
- H342 (= H363) binding
- D379 (= D400) binding
- H380 (= H401) binding
- H454 (= H499) binding
- C489 (≠ D534) modified: Disulfide link with 496
Sites not aligning to the query:
- 1:22 signal peptide
- 25 P → L: in dbSNP:rs1130335
- 496 modified: Disulfide link with 489
- 506 modified: GPI-anchor amidated aspartate
P19111 Intestinal-type alkaline phosphatase; IAP; Intestinal alkaline phosphatase; EC 3.1.3.1 from Bos taurus (Bovine) (see 2 papers)
43% identity, 84% coverage: 75:533/545 of query aligns to 51:485/533 of P19111
- S111 (= S135) active site, Phosphoserine intermediate
Sites not aligning to the query:
1k7hA Crystal structure of shrimp alkaline phosphatase (see paper)
40% identity, 88% coverage: 53:532/545 of query aligns to 7:465/476 of 1k7hA
- active site: D37 (= D85), S86 (= S135), H149 (= H196), T151 (= T198), R162 (= R209), E310 (= E354), D315 (= D359), H316 (= H360), H319 (= H363), D356 (= D400), H357 (= H401), H432 (= H499)
- binding zinc ion: D37 (= D85), D37 (= D85), S86 (= S135), H149 (= H196), T151 (= T198), E310 (= E354), D315 (= D359), H319 (= H363), D356 (= D400), H357 (= H401), H432 (= H499)
1shqA Crystal structure of shrimp alkaline phosphatase with magnesium in m3 (see paper)
40% identity, 88% coverage: 53:532/545 of query aligns to 7:465/476 of 1shqA
- active site: D37 (= D85), S86 (= S135), H149 (= H196), T151 (= T198), R162 (= R209), E310 (= E354), D315 (= D359), H316 (= H360), H319 (= H363), D356 (= D400), H357 (= H401), H432 (= H499)
- binding magnesium ion: D37 (= D85), T151 (= T198), E310 (= E354)
- binding zinc ion: D37 (= D85), S86 (= S135), D315 (= D359), H319 (= H363), D356 (= D400), H357 (= H401), H432 (= H499)
1shnA Crystal structure of shrimp alkaline phosphatase with phosphate bound (see paper)
40% identity, 88% coverage: 53:532/545 of query aligns to 7:465/476 of 1shnA
- active site: D37 (= D85), S86 (= S135), H149 (= H196), T151 (= T198), R162 (= R209), E310 (= E354), D315 (= D359), H316 (= H360), H319 (= H363), D356 (= D400), H357 (= H401), H432 (= H499)
- binding phosphate ion: D85 (= D134), S86 (= S135), R162 (= R209), D315 (= D359), H319 (= H363), H432 (= H499)
- binding zinc ion: D37 (= D85), D37 (= D85), S86 (= S135), H149 (= H196), T151 (= T198), E310 (= E354), D315 (= D359), H319 (= H363), D356 (= D400), H357 (= H401), H432 (= H499)
7qowB Crystal structure of vibrio alkaline phosphatase in 1.0 m nacl (see paper)
33% identity, 60% coverage: 77:401/545 of query aligns to 4:316/505 of 7qowB
- binding chloride ion: R129 (= R209)
- binding magnesium ion: D12 (= D85), A45 (≠ P118), Q46 (≠ H119), G48 (vs. gap), T118 (= T198), E268 (= E354)
- binding phosphate ion: S65 (= S135), R129 (= R209), D273 (= D359)
- binding zinc ion: D12 (= D85), S65 (= S135), D273 (= D359), H277 (= H363), D315 (= D400), H316 (= H401)
Sites not aligning to the query:
7tm9A Crystal structure of bacterial alkaline phosphatase from klebsiella pneumoniae
34% identity, 61% coverage: 76:407/545 of query aligns to 34:368/441 of 7tm9A
Sites not aligning to the query:
1kh5A E. Coli alkaline phosphatase mutant (d330n) mimic of the transition states with aluminium fluoride (see paper)
33% identity, 66% coverage: 57:413/545 of query aligns to 16:377/444 of 1kh5A
Sites not aligning to the query:
5c66A E. Coli alkaline phosphatase in complex with tungstate (see paper)
34% identity, 62% coverage: 76:413/545 of query aligns to 34:374/441 of 5c66A
- active site: D43 (= D85), S94 (= S135), D145 (≠ H196), T147 (= T198), R158 (= R209), E314 (= E354), D319 (= D359), K320 (≠ H360), H323 (= H363), D361 (= D400), H362 (= H401)
- binding tungstate(vi)ion: D43 (= D85), D93 (= D134), S94 (= S135), R158 (= R209), D319 (= D359), H323 (= H363), H362 (= H401)
- binding zinc ion: D43 (= D85), D43 (= D85), S94 (= S135), T147 (= T198), E314 (= E354), D319 (= D359), H323 (= H363), D361 (= D400), H362 (= H401)
Sites not aligning to the query:
Query Sequence
>5208648 FitnessBrowser__PV4:5208648
MNKKLLVLSLAAILGLAACGSDGDNGKDGTAGTPGTDGSNGTNGKDWTGVNQWYVDGQNR
VTKASGMTNNNEAGAAKNIILFVGDGMGVSTVTAARILDGQLKGQTGEENSLSFETLPHL
GLAKTYNVDGQTPDSAGTMTAMVTGVKTDVGVISQGEGVERGVCSSTTGQDLVTSLELAA
MAGMSTGVVSTARITHATPAATYAHVPERDWEADSNLPAEAVTNGCKDIAAQMLDFNDGK
GINVVMGGGRRAFIPNTTVDPEGKAGKRKDGRDLTAEWMAQYPNAAYVTDRDSFLAMDTS
TTEHALGLFNSSHMEYDYDRVEDGVNGEPSLAEMTAKSIDILSKNDKGFVLIVEAGRIDH
AHHAGNAARALHDTIALSEAVRVAMEKTSANDTLLMVTADHSHVFTIAGYPTRGNPILGL
VKSNDSNGQPSVTNSTDANGMPYTTVGYANGLGFGSLETGGDERYNYAAEPGRVDLNYID
TQSAGFHQEALVPLESETHAGEDVAIFARGPGASLVEGTVEQNHIFHVMNYAGDLVKKAE
AAAAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory