SitesBLAST
Comparing 5208721 FitnessBrowser__PV4:5208721 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
38% identity, 96% coverage: 9:406/416 of query aligns to 7:425/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
38% identity, 96% coverage: 9:406/416 of query aligns to 6:424/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ Q179), G195 (≠ M183), R282 (= R271)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A260), S272 (= S261), S273 (= S262), M307 (= M295), T310 (≠ C298), G353 (= G342), A354 (≠ S343), R394 (= R376), T395 (= T377)
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
38% identity, 96% coverage: 9:406/416 of query aligns to 9:427/427 of 5e9sA
- binding aspartic acid: R274 (≠ A260), S275 (= S261), S276 (= S262), T313 (≠ C298), G353 (= G339), V354 (= V340), A357 (≠ S343), G358 (≠ A344), D394 (= D373), R397 (= R376), T398 (= T377)
- binding decyl-beta-d-maltopyranoside: L194 (≠ Q179), G198 (≠ M183), Y202 (≠ L187)
- binding sodium ion: Y87 (≠ F82), T90 (= T85), S91 (≠ G86), S276 (= S262), G305 (= G290), A306 (= A291), T307 (= T292), N309 (= N294), N309 (= N294), M310 (= M295), D311 (= D296), S348 (= S334), I349 (≠ V335), G350 (= G336), T351 (= T337), N401 (= N380), V402 (= V381), D405 (= D384)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
38% identity, 96% coverage: 1:400/416 of query aligns to 3:421/425 of O59010
- S65 (≠ A57) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A260) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 260:262) binding
- M311 (= M295) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ C298) binding
- V355 (= V340) binding
- D394 (= D373) binding
- M395 (= M374) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R376) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N380) binding
- D405 (= D384) mutation to N: Strongly decreased affinity for aspartate.
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
39% identity, 95% coverage: 9:403/416 of query aligns to 9:424/426 of 6xwnB
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
38% identity, 96% coverage: 9:406/416 of query aligns to 2:416/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A260), S265 (= S262), M299 (= M295), T302 (≠ C298), T340 (= T337), G342 (= G339), V343 (= V340), G347 (≠ A344), D383 (= D373), R386 (= R376), T387 (= T377), N390 (= N380)
- binding decyl-beta-d-maltopyranoside: H23 (≠ E30), V212 (≠ L208), A216 (≠ G212)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
38% identity, 96% coverage: 1:398/416 of query aligns to 3:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ W2), Y7 (≠ I5), F46 (≠ L38), F46 (≠ L38), P75 (≠ D68), L91 (= L84), F95 (≠ I88), L130 (≠ F121), I133 (≠ V124), I159 (≠ A150), Y167 (vs. gap), K196 (≠ Q179), G200 (≠ M183), I207 (= I190), F210 (= F193), L250 (= L233), I262 (≠ F246), M269 (≠ Q253), T334 (≠ E319), V335 (≠ M320), G336 (≠ T321), T340 (≠ L325), L343 (≠ V328), M399 (≠ A378)
- binding aspartic acid: S277 (= S261), S278 (= S262), T314 (≠ C298), G354 (= G339), A358 (≠ S343), G359 (≠ A344), D394 (= D373), R397 (= R376), T398 (= T377)
- binding sodium ion: Y89 (≠ F82), T92 (= T85), S93 (≠ G86), G306 (= G290), T308 (= T292), N310 (= N294), N310 (= N294), M311 (= M295), D312 (= D296), S349 (= S334), I350 (≠ V335), T352 (= T337), N401 (= N380), V402 (= V381), D405 (= D384)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
38% identity, 93% coverage: 9:395/416 of query aligns to 2:407/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
38% identity, 95% coverage: 2:395/416 of query aligns to 1:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ I5), G66 (≠ S61), V83 (≠ L79), I157 (≠ L151), Y164 (vs. gap), K193 (≠ Q179), T305 (= T292), I306 (≠ M293), I347 (≠ V335)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V14), M199 (≠ L185), S275 (= S262), T311 (≠ C298), G356 (≠ A344), L384 (≠ A366), D391 (= D373), R394 (= R376)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
38% identity, 94% coverage: 7:396/416 of query aligns to 1:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
38% identity, 94% coverage: 7:395/416 of query aligns to 1:408/408 of 6bauA
- binding cysteine: S270 (= S262), M303 (= M295), T306 (≠ C298), A345 (= A338), G346 (= G339), V347 (= V340), G351 (≠ A344), D386 (= D373), C389 (≠ R376), T390 (= T377), N393 (= N380)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
36% identity, 94% coverage: 7:395/416 of query aligns to 1:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
31% identity, 88% coverage: 39:402/416 of query aligns to 57:410/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (= S70), G89 (≠ K72), G92 (≠ S75), A95 (≠ T78), V96 (≠ L79), Y99 (≠ F82), M163 (≠ A150), F167 (≠ I154), F293 (= F285), V297 (≠ L289)
- binding aspartic acid: S268 (= S261), S269 (= S262), T306 (≠ C298), G346 (= G339), I347 (≠ V340), A350 (≠ S343), G351 (≠ A344), D380 (= D373), R383 (= R376), T384 (= T377)
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
29% identity, 96% coverage: 15:414/416 of query aligns to 49:510/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
30% identity, 87% coverage: 39:399/416 of query aligns to 47:419/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S261), S281 (= S262), T318 (≠ C298), G363 (≠ A344), M367 (≠ L348), V385 (≠ A366), D388 (= D369), R395 (= R376), T396 (= T377)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R370)
- binding cholesterol hemisuccinate: R80 (= R73), R84 (≠ K77), I95 (= I88), I252 (≠ V229)
Sites not aligning to the query:
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
31% identity, 86% coverage: 39:395/416 of query aligns to 39:402/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ A57), L58 (≠ I58), L65 (= L65), V339 (= V335), G340 (= G336), S343 (≠ G339), I344 (≠ V340)
- binding cholesterol: W188 (≠ Q186), I227 (vs. gap), F250 (= F246), W257 (≠ Q253), M379 (≠ I375), S382 (≠ A378)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S262), M300 (= M295), T303 (≠ C298), Y306 (= Y302), G348 (≠ A344), L349 (≠ M345), M352 (≠ L348), I366 (= I362), L369 (≠ I365), V370 (≠ A366), D373 (= D369), D377 (= D373), R380 (= R376), T381 (= T377), N384 (= N380)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
30% identity, 87% coverage: 39:399/416 of query aligns to 46:420/425 of 7xr4A
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
30% identity, 93% coverage: 15:400/416 of query aligns to 12:411/416 of 8cuaA
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
36% identity, 63% coverage: 141:400/416 of query aligns to 168:429/433 of 8cv2A
Sites not aligning to the query:
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
31% identity, 88% coverage: 39:402/416 of query aligns to 49:396/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I62), S80 (= S70), G81 (≠ K72), G84 (≠ S75), Y91 (≠ F82), M156 (≠ A150), F160 (≠ I154), F286 (= F285), V290 (≠ L289)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I54), I148 (≠ V142), S262 (= S262), S263 (≠ F263), A292 (= A291), T293 (= T292), M296 (= M295), T299 (≠ C298), G329 (= G336), A336 (≠ S343), G337 (≠ A344), D366 (= D373), R369 (= R376), N373 (= N380)
Query Sequence
>5208721 FitnessBrowser__PV4:5208721
MWQTIKQIPFWQKVLAGFILGVGLGVVLGEQATQLKPLGDLFIAAIKMLVAPLIFCAIVV
SITSLGNDVSLKRLSIKTLAMFMLTGTIASLIGLAIGSLIDMGGSLELATTEVRERNVPG
FAQVLLDMIPVNPFASLAEGKVLQIIVFAALVGIAINKIGEKAEPLKRTIEAGAEVMFQL
TRMVLQLTPIGVFGLMAWVVGEYGLSTLLPLGKFIGAIYIAALIHMVFVYGGLVRFGAGL
SAVQFFRKAMPAQLVAFTTASSFGTLPASTRATETMGVSKKYGAFVLPLGATMNMDGCGG
IYPAIAAIFIAQIYGIPLEMTDYMLIAVTATVASVGTAGVPGSAMVMLSVTLGVVGLPLE
GIAFIASIDRVIDMIRTATNVTGDMMTAVVVGKSEGQLDQEQFYRNEESDAPEVAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory