Comparing 5208773 FitnessBrowser__PV4:5208773 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3cv1A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
70% identity, 94% coverage: 28:538/544 of query aligns to 20:528/529 of 3cv1A
3cuzA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
70% identity, 94% coverage: 28:538/544 of query aligns to 20:528/529 of 3cuzA
3cv2A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
70% identity, 94% coverage: 28:538/544 of query aligns to 15:523/524 of 3cv2A
3cuxA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
51% identity, 94% coverage: 28:538/544 of query aligns to 13:501/501 of 3cuxA
P30952 Malate synthase 1; EC 2.3.3.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
48% identity, 86% coverage: 28:493/544 of query aligns to 31:498/554 of P30952
Sites not aligning to the query:
5cahA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6h-thieno[2,3-b]pyrrole-5-carboxylic acid (see paper)
23% identity, 68% coverage: 100:470/544 of query aligns to 245:629/706 of 5cahA
6dljA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-nitro-phenyldiketoacid (see paper)
22% identity, 68% coverage: 100:470/544 of query aligns to 244:630/704 of 6dljA
Sites not aligning to the query:
1n8iA Biochemical and structural studies of malate synthase from mycobacterium tuberculosis (see paper)
22% identity, 68% coverage: 100:470/544 of query aligns to 243:628/701 of 1n8iA
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
23% identity, 68% coverage: 100:470/544 of query aligns to 249:635/712 of 6dnpA
5cjmA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4h-thieno[3,2-b]pyrrole-5-carboxylic acid (see paper)
22% identity, 68% coverage: 100:470/544 of query aligns to 249:634/711 of 5cjmA
Sites not aligning to the query:
5cc7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-indole-6-carboxylic acid
22% identity, 68% coverage: 100:470/544 of query aligns to 246:631/704 of 5cc7A
Sites not aligning to the query:
6c7bA Crystal structure of mycobacterium tuberculosis malate synthase in complex with methoxynaphthyldiketoacid (see paper)
22% identity, 68% coverage: 100:470/544 of query aligns to 249:635/710 of 6c7bA
6c8pA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-phenyldiketoacid (see paper)
22% identity, 68% coverage: 100:470/544 of query aligns to 249:639/716 of 6c8pA
5cc6A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-indole-5-carboxylic acid
22% identity, 68% coverage: 100:470/544 of query aligns to 243:628/701 of 5cc6A
Sites not aligning to the query:
3sadA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-(2-mehtylphenyl)-2,4-dioxobutanoic acid inhibitor (see paper)
22% identity, 68% coverage: 100:470/544 of query aligns to 246:634/709 of 3sadA
3sb0A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-(2-chloro-6-fluoro-3-methylphenyl)-2,4-dioxobutanoic acid inhibitor (see paper)
22% identity, 68% coverage: 100:470/544 of query aligns to 245:631/708 of 3sb0A
Sites not aligning to the query:
3s9iA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-4-dioxo-4-phenylbutanoic acid inhibitor (see paper)
22% identity, 68% coverage: 100:470/544 of query aligns to 249:638/714 of 3s9iA
6apzA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-hydroxy-phenyldiketoacid (see paper)
22% identity, 68% coverage: 100:470/544 of query aligns to 246:633/707 of 6apzA
6bu1A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-3-oh-phenyldiketoacid (see paper)
23% identity, 68% coverage: 100:470/544 of query aligns to 248:635/712 of 6bu1A
Sites not aligning to the query:
5driA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(1h-indol-5-yl)-4-oxobut-2-enoic acid inhibitor (see paper)
22% identity, 68% coverage: 100:470/544 of query aligns to 246:635/708 of 5driA
>5208773 FitnessBrowser__PV4:5208773
MTEQVMNKHQLETGLSILGAPVPGQEIVLNEGALSLLEVLCDQFAAEVPKLLEMRRQKQE
LIDKGSLPDFLPETRAIRDGDWQIRGIPQDLQDRRVEITGPVDRKMIINALNANVKVFMA
DFEDSLAPSWIKVIQGQINLRDAVRGEIEYTAPETGKHYTLDDDPAVLIARVRGLHLKEK
HVAFNGEAIPGALFDFCLYFYHNYRQLLEKGSGPYFYIPKLESHVEARWWAKVFAYVEER
FCLTPGTIKCTCLIETLPAVFEMEEILYELRSNIVALNCGRWDYIFSYIKTLKKHSDRIL
PDRQAVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDQAQNEAVLVKVRGDKEL
EARNGHDGTWVAHPGLADTAMGIFNEYIGEDHVNQLHITRDVDAPILARDLLMPCEGERT
ESGMRLNIRIALQYIEAWIRGNGCVPIYGLMEDAATAEISRTSIWQWIQHEQKLSNGKLV
TKALFKEMLVEELANVKLEVGPDRFTHGSFTQAAVLLEEITTADELVDFLTLPGYEILTQ
GDNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory