SitesBLAST
Comparing 5208820 FitnessBrowser__PV4:5208820 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
35% identity, 99% coverage: 2:240/242 of query aligns to 5:244/246 of 3osuA
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 99% coverage: 2:240/242 of query aligns to 6:245/247 of 4jroC
- active site: G16 (= G12), S142 (= S137), Q152 (≠ L147), Y155 (= Y150), K159 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G8), S14 (= S10), R15 (= R11), G16 (= G12), I17 (≠ L13), N35 (≠ K27), Y36 (≠ V28), N37 (≠ S29), G38 (≠ T30), S39 (≠ C31), N63 (≠ E55), V64 (≠ I56), N90 (= N84), A91 (= A85), I93 (= I87), I113 (≠ V107), S142 (= S137), Y155 (= Y150), K159 (= K154), P185 (= P180), I188 (≠ L183), T190 (= T185)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 99% coverage: 2:240/242 of query aligns to 6:241/244 of P0A2C9
- M125 (≠ F123) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ L222) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S223) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 99% coverage: 2:240/242 of query aligns to 6:241/244 of P0AEK2
- GASR 12:15 (≠ GGSR 8:11) binding
- T37 (≠ R33) binding
- NV 59:60 (≠ EI 55:56) binding
- N86 (= N84) binding
- Y151 (= Y150) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSASK 150:154) binding
- A154 (≠ S153) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K154) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ L183) binding
- E233 (≠ Q232) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
36% identity, 99% coverage: 2:240/242 of query aligns to 5:240/243 of 1q7bA
- active site: G15 (= G12), E101 (= E100), S137 (= S137), Q147 (≠ L147), Y150 (= Y150), K154 (= K154)
- binding calcium ion: E232 (≠ Q232), T233 (= T233)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G8), S13 (= S10), R14 (= R11), T36 (≠ R33), N58 (≠ E55), V59 (≠ I56), N85 (= N84), A86 (= A85), G87 (= G86), I88 (= I87), S137 (= S137), Y150 (= Y150), K154 (= K154), P180 (= P180), G181 (= G181), I183 (≠ L183)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
36% identity, 99% coverage: 2:240/242 of query aligns to 6:241/244 of 6t62A
- active site: G16 (= G12), S138 (= S137), Y151 (= Y150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G8), S14 (= S10), R15 (= R11), A36 (≠ S32), T37 (≠ R33), L58 (≠ C54), D59 (≠ E55), V60 (≠ I56), N86 (= N84), A87 (= A85), G88 (= G86), I89 (= I87), I136 (= I135), S137 (= S136), S138 (= S137), Y151 (= Y150), K155 (= K154), P181 (= P180), G182 (= G181), I184 (≠ L183), M188 (= M187)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
36% identity, 99% coverage: 2:240/242 of query aligns to 6:241/244 of 6wprA
- active site: G16 (= G12), S138 (= S137), Y151 (= Y150)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G8), S14 (= S10), R15 (= R11), T37 (≠ R33), L58 (≠ C54), D59 (≠ E55), V60 (≠ I56), N86 (= N84), A87 (= A85), G88 (= G86), I89 (= I87), I136 (= I135), Y151 (= Y150), K155 (= K154), P181 (= P180)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
37% identity, 99% coverage: 2:240/242 of query aligns to 5:240/243 of 7emgB
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
36% identity, 99% coverage: 2:240/242 of query aligns to 5:240/243 of 1q7cA
- active site: G15 (= G12), S137 (= S137), Q147 (≠ L147), F150 (≠ Y150), K154 (= K154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G8), S13 (= S10), R14 (= R11), A35 (≠ S32), T36 (≠ R33), L57 (≠ C54), N58 (≠ E55), V59 (≠ I56), G87 (= G86), I88 (= I87)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
36% identity, 99% coverage: 2:240/242 of query aligns to 13:251/254 of 4ag3A
- active site: G23 (= G12), S148 (= S137), Y161 (= Y150), K165 (= K154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G8), S21 (= S10), R22 (= R11), G23 (= G12), I24 (≠ L13), T44 (= T30), L68 (≠ C54), D69 (≠ E55), V70 (≠ I56), N96 (= N84), A97 (= A85), I146 (= I135), S148 (= S137), Y161 (= Y150), K165 (= K154), P191 (= P180), G192 (= G181), F193 (≠ Y182), I194 (≠ L183), T196 (= T185), M198 (= M187), T199 (≠ S188)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
35% identity, 99% coverage: 2:240/242 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G12), S138 (= S137), Q148 (≠ L147), Y151 (= Y150), K155 (= K154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), S10 (= S10), R11 (= R11), I13 (≠ L13), N31 (vs. gap), Y32 (vs. gap), A33 (vs. gap), G34 (vs. gap), S35 (≠ C31), A58 (≠ C54), N59 (≠ E55), V60 (≠ I56), N86 (= N84), A87 (= A85), T109 (≠ V107), S138 (= S137), Y151 (= Y150), K155 (= K154), P181 (= P180), G182 (= G181)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
35% identity, 99% coverage: 2:240/242 of query aligns to 6:241/244 of 6t77A
- active site: G16 (= G12), S138 (= S137), Y151 (= Y150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G8), S14 (= S10), R15 (= R11), T37 (≠ R33), L58 (≠ C54), N59 (≠ E55), V60 (≠ I56), A87 (= A85), G88 (= G86), I89 (= I87)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 99% coverage: 2:240/242 of query aligns to 9:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G8), S17 (= S10), R18 (= R11), I20 (≠ L13), T40 (≠ R33), N62 (≠ E55), V63 (≠ I56), N89 (= N84), A90 (= A85), I92 (= I87), V139 (≠ I135), S141 (= S137), Y154 (= Y150), K158 (= K154), P184 (= P180), G185 (= G181), I187 (≠ L183), T189 (= T185), M191 (= M187)
7caxD Crystal structure of bacterial reductase
32% identity, 99% coverage: 2:240/242 of query aligns to 2:237/238 of 7caxD
- active site: G12 (= G12), S139 (= S137), Y152 (= Y150)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), S10 (= S10), R11 (= R11), I13 (≠ L13), H31 (≠ C31), R33 (= R33), S34 (≠ A34), R35 (≠ T35), D59 (≠ P53), V60 (≠ C54), N86 (= N84), A87 (= A85), G88 (= G86), S139 (= S137), Y152 (= Y150), K156 (= K154), P182 (= P180), G183 (= G181), I185 (≠ L183)
P73826 Acetoacetyl-CoA reductase; EC 1.1.1.36 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
35% identity, 98% coverage: 2:238/242 of query aligns to 9:236/240 of P73826
- S134 (= S137) mutation to A: 12% enzymatic activity.
- Y147 (= Y150) mutation to A: No enzymatic activity.
- K151 (= K154) mutation to A: 5% enzymatic activity.
P71534 3-oxoacyl-[acyl-carrier-protein] reductase MabA; 3-ketoacyl-acyl carrier protein reductase; Acetoacetyl-CoA reductase; Beta-ketoacyl-ACP reductase; Beta-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100; EC 1.1.1.36 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 99% coverage: 2:240/242 of query aligns to 24:251/255 of P71534
5ovkA Crystal structure maba bound to NADPH from m. Smegmatis (see paper)
33% identity, 99% coverage: 2:240/242 of query aligns to 11:238/242 of 5ovkA
5ovlA Crystal structure of maba bound to NADP+ from m. Smegmatis (see paper)
33% identity, 99% coverage: 2:240/242 of query aligns to 10:237/241 of 5ovlA
- active site: G20 (= G12), S134 (= S137), Y147 (= Y150), L154 (= L157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G8), N18 (≠ S10), R19 (= R11), G20 (= G12), I21 (≠ L13), R41 (= R33), D55 (≠ E55), V56 (≠ I56), N82 (= N84), A83 (= A85), I85 (= I87), T105 (≠ V107), I132 (= I135), S134 (= S137), Y147 (= Y150), K151 (= K154), P177 (= P180), G178 (= G181), I180 (≠ L183)
8jfgA Crystal structure of 3-oxoacyl-acp reductase fabg in complex with NADP+ and 3-keto-octanoyl-acp from helicobacter pylori (see paper)
33% identity, 99% coverage: 2:240/242 of query aligns to 7:246/248 of 8jfgA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G8), K16 (≠ R11), I18 (≠ L13), R38 (= R33), A65 (= A59), N91 (= N84), A92 (= A85), G93 (= G86), A142 (≠ S136), S143 (= S137), Y156 (= Y150), K160 (= K154), P186 (= P180), I189 (≠ L183), T191 (= T185), M193 (= M187), N194 (≠ S188)
- binding ~{S}-[2-[3-[[(2~{S})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] 3-oxidanylideneoctanethioate: D97 (≠ E90), S143 (= S137), I145 (= I139), M151 (≠ T145), G152 (= G146), Q153 (≠ L147), Y156 (= Y150), G187 (= G181), F188 (≠ Y182), Y205 (≠ I199)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
35% identity, 99% coverage: 2:240/242 of query aligns to 9:240/243 of 4i08A
- active site: G19 (= G12), N113 (= N108), S141 (= S137), Q151 (≠ L147), Y154 (= Y150), K158 (= K154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G8), S17 (= S10), R18 (= R11), I20 (≠ L13), T40 (≠ R33), N62 (≠ E55), V63 (≠ I56), N89 (= N84), A90 (= A85), G140 (≠ S136), S141 (= S137), Y154 (= Y150), K158 (= K154), P184 (= P180), G185 (= G181), T189 (= T185)
Query Sequence
>5208820 FitnessBrowser__PV4:5208820
MKHIIVTGGSRGLGLAIVTHLLAQGYKVSTCSRATTSTIEALEQSNPNFKWFPCEIGNAE
QTSQFVKEACIWANESPLWGLINNAGIAKEGVLATFPNIESDALIQVNLNGALYTAREVL
RVFLRQNSAGRIINISSIIGSRGYTGLAAYSASKAGLDGLTRALARENGRRNITVNSIAP
GYLDTEMSSTLSDKKRDQIIRRTPMHRLGKVDDITPAISFLLSDGAAFITGQTLTIDGGI
TN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory