Comparing 5208824 FitnessBrowser__PV4:5208824 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
34% identity, 96% coverage: 6:249/253 of query aligns to 1:242/248 of Q9KJF1
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
34% identity, 93% coverage: 14:249/253 of query aligns to 8:241/247 of 7pcsB
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
34% identity, 97% coverage: 6:251/253 of query aligns to 1:246/247 of 4jroC
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
36% identity, 96% coverage: 6:249/253 of query aligns to 8:250/254 of 4ag3A
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
33% identity, 96% coverage: 6:249/253 of query aligns to 4:243/247 of 3op4A
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
36% identity, 96% coverage: 6:249/253 of query aligns to 3:237/241 of 4bnzA
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
34% identity, 94% coverage: 11:249/253 of query aligns to 5:243/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
34% identity, 94% coverage: 11:249/253 of query aligns to 2:236/239 of 3sj7A
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
33% identity, 96% coverage: 6:249/253 of query aligns to 4:239/243 of 4i08A
4bnxA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 6-(4-(2-chloroanilino)- 1h-quinazolin-2-ylidene)cyclohexa-2, 4-dien-1-one at 2.3a resolution (see paper)
36% identity, 96% coverage: 6:249/253 of query aligns to 3:236/239 of 4bnxA
4bnyA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 4-(2-phenylthieno(3,2-d) pyrimidin-4-yl)morpholine at 1.8a resolution (see paper)
36% identity, 96% coverage: 6:249/253 of query aligns to 2:235/239 of 4bnyA
4bo9A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 5-(2-(furan-2-ylmethoxy) phenyl)-2-phenyltetrazole at 2.9a resolution (see paper)
36% identity, 96% coverage: 6:249/253 of query aligns to 3:231/235 of 4bo9A
4bnuA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 2-phenyl-4-(1,2,4- triazol-4-yl)quinazoline at 2.0a resolution (see paper)
37% identity, 96% coverage: 6:249/253 of query aligns to 3:235/239 of 4bnuA
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 96% coverage: 6:249/253 of query aligns to 1:240/244 of P0AEK2
4bo7A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2,3-dihydro-1h-inden- 5-yl)tetrazolo(1,5-b)pyridazin-6-amine at 2.6a resolution (see paper)
36% identity, 96% coverage: 6:249/253 of query aligns to 3:234/238 of 4bo7A
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
36% identity, 96% coverage: 6:249/253 of query aligns to 14:251/255 of 4bo4C
4bo0A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(4-methoxy-1- methylindazol-3-yl)-3-(2-methoxyphenyl)urea at 2.4a resolution (see paper)
36% identity, 96% coverage: 6:249/253 of query aligns to 2:231/235 of 4bo0A
4bo2A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(1-ethylbenzimidazol-2- yl)-3-(2-methoxyphenyl)urea at 1.9a resolution (see paper)
36% identity, 96% coverage: 6:249/253 of query aligns to 5:234/238 of 4bo2A
4bo8A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(2-amino-4- phenylimidazol-1-yl)-3-(2-fluorophenyl)urea at 2.7a resolution (see paper)
36% identity, 96% coverage: 6:249/253 of query aligns to 3:232/236 of 4bo8A
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
32% identity, 94% coverage: 11:249/253 of query aligns to 1:241/245 of 4k6fB
>5208824 FitnessBrowser__PV4:5208824
MNVNPMDFSGKRVLVTGASAGIGKACAILFSQLGAQVILNGRNSKALEQTLTELSGNGHV
CAPFDMADTDKLTDWVKMLVKEHGYLDGFVHCAGIQITKPIRLFDQAFFDETMHVNLASA
MAISKGFRLKRDRSKQGAIVFVSSIAGLIGQTGNTLYGASKAGLMSLTRGLAMELLRDNI
RVNCVAPALVATEMATRTQESMTEAQFQHMLDQHPMGLGQPEDVANAVAFLLSDAAKWIN
AVTLPVEGGYLAN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory