SitesBLAST
Comparing 5208906 FitnessBrowser__PV4:5208906 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
31% identity, 98% coverage: 2:243/246 of query aligns to 5:252/255 of 5itvA
- active site: G18 (= G15), S141 (= S142), Y154 (= Y153), K158 (= K157)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G11), S17 (= S14), G18 (= G15), I19 (= I16), D38 (≠ G35), I39 (≠ R36), T61 (≠ L58), I63 (≠ V60), N89 (= N87), G91 (= G89), T139 (≠ I140), S141 (= S142), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (= G184), I186 (= I185), I187 (≠ V186)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
35% identity, 100% coverage: 2:246/246 of query aligns to 8:247/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G11), D19 (≠ G13), L22 (≠ I16), I42 (≠ K38), D65 (= D59), M66 (≠ V60), N92 (= N87), A93 (= A88), G94 (= G89), L115 (≠ V110), I143 (= I140), S145 (= S142), Y158 (= Y151), K162 (= K157), G189 (= G184), M191 (≠ V186), T193 (= T188), N195 (≠ M190)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 99% coverage: 2:245/246 of query aligns to 3:243/244 of P0A2C9
- M125 (≠ W126) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ V225) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S226) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
37% identity, 99% coverage: 2:244/246 of query aligns to 5:247/249 of 3uf0A
- active site: G18 (= G15), S141 (= S142), V151 (≠ A148), Y154 (= Y151), K158 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G11), S17 (= S14), G18 (= G15), I19 (= I16), R39 (= R36), D63 (= D59), L64 (≠ V60), N89 (= N87), G91 (= G89), I92 (= I90), I139 (= I140), A140 (≠ S141), S141 (= S142), Y154 (= Y151), K158 (= K157), P184 (= P183), G185 (= G184), V187 (= V186), T189 (= T188), N191 (≠ M190), T192 (≠ Q191)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
33% identity, 98% coverage: 5:245/246 of query aligns to 3:255/256 of Q48436
- 6:33 (vs. 8:35, 54% identical) binding
- D59 (= D59) binding
- K156 (= K157) binding
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
34% identity, 99% coverage: 2:245/246 of query aligns to 3:243/244 of 6t77A
- active site: G16 (= G15), S138 (= S142), Y151 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (≠ G13), R15 (≠ S14), T37 (≠ R36), L58 (= L58), N59 (≠ D59), V60 (= V60), A87 (= A88), G88 (= G89), I89 (= I90)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
34% identity, 98% coverage: 2:242/246 of query aligns to 5:254/258 of 3ak4A
- active site: G18 (= G15), S141 (= S142), L151 (vs. gap), Y154 (= Y153), K158 (= K157), E199 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ S14), G18 (= G15), I19 (= I16), D38 (≠ G35), L39 (≠ R36), V60 (≠ L58), D61 (= D59), V62 (= V60), N88 (= N87), A89 (= A88), G90 (= G89), T139 (≠ I140), S141 (= S142), Y154 (= Y153), K158 (= K157), G185 (= G184), V187 (= V186), T189 (= T188), M191 (= M190)
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
33% identity, 98% coverage: 5:245/246 of query aligns to 3:255/256 of 1gegE
- active site: G13 (= G15), S139 (= S142), Y152 (= Y153), K156 (= K157), V197 (≠ D198)
- binding alpha-D-glucopyranose: R63 (≠ I63), D64 (≠ S64), F67 (≠ K67), E123 (≠ S124)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), Q12 (≠ S14), I14 (= I16), D33 (≠ G35), Y34 (≠ R36), V58 (≠ L58), D59 (= D59), V60 (= V60), N86 (= N87), A87 (= A88), I109 (≠ V110), S139 (= S142), Y152 (= Y153), K156 (= K157), P182 (= P183), V185 (= V186), T187 (= T188), M189 (= M190)
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
31% identity, 99% coverage: 2:245/246 of query aligns to 6:251/251 of 4cqlI
- active site: G19 (= G15), S146 (= S142), Y159 (= Y153), K163 (= K157)
- binding nicotinamide-adenine-dinucleotide: S18 (= S14), G19 (= G15), I20 (= I16), D39 (≠ G35), L40 (≠ R36), A64 (≠ L58), D65 (= D59), V66 (= V60), C93 (≠ N87), A94 (= A88), G95 (= G89), I96 (= I90), V116 (= V110), I144 (= I140), S146 (= S142), Y159 (= Y153), K163 (= K157), P189 (= P183), G190 (= G184), I192 (≠ V186), T194 (= T188), M196 (= M190)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
33% identity, 98% coverage: 2:241/246 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), M16 (≠ I16), D35 (≠ G35), I36 (≠ R36), I62 (≠ V60), N88 (= N87), G90 (= G89), I138 (= I140), S140 (= S142), Y152 (= Y153), K156 (= K157), I185 (≠ V186)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
33% identity, 98% coverage: 2:241/246 of query aligns to 3:242/248 of Q9KJF1
- S15 (= S14) binding
- D36 (≠ G35) binding
- D62 (= D59) binding
- I63 (≠ V60) binding
- N89 (= N87) binding
- Y153 (= Y153) binding
- K157 (= K157) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
32% identity, 99% coverage: 2:245/246 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G15), S142 (= S142), Q152 (≠ T150), Y155 (= Y153), K159 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (≠ G13), R15 (≠ S14), G16 (= G15), I17 (= I16), N35 (≠ C34), Y36 (≠ G35), N37 (≠ R36), G38 (≠ D37), S39 (≠ K38), N63 (≠ S61), V64 (vs. gap), N90 (= N87), A91 (= A88), I93 (= I90), I113 (≠ V110), S142 (= S142), Y155 (= Y153), K159 (= K157), P185 (= P183), I188 (≠ V186), T190 (= T188)
4cqmA Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
30% identity, 99% coverage: 2:245/246 of query aligns to 4:248/248 of 4cqmA
- active site: G17 (= G15), S143 (= S142), Y156 (= Y153), K160 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), S16 (= S14), G17 (= G15), I18 (= I16), D37 (≠ G35), L38 (≠ R36), A61 (≠ L58), V63 (= V60), C90 (≠ N87), A91 (= A88), G92 (= G89), I93 (= I90), V113 (= V110), I141 (= I140), S143 (= S142), Y156 (= Y153), K160 (= K157), P186 (= P183), G187 (= G184), I189 (≠ V186), T191 (= T188), P192 (≠ D189), M193 (= M190), T194 (≠ Q191)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
34% identity, 99% coverage: 2:245/246 of query aligns to 6:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G11), S17 (≠ G13), R18 (≠ S14), I20 (= I16), T40 (≠ R36), N62 (≠ D59), V63 (= V60), N89 (= N87), A90 (= A88), I92 (= I90), V139 (≠ I140), S141 (= S142), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (= G184), I187 (≠ V186), T189 (= T188), M191 (= M190)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
36% identity, 100% coverage: 2:246/246 of query aligns to 6:246/246 of 4hp8B
- active site: G19 (= G15), S138 (= S142), V148 (≠ A148), Y151 (= Y151), K155 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G11), N17 (≠ G13), T18 (≠ S14), G19 (= G15), L20 (≠ I16), R40 (= R36), R41 (≠ D37), D63 (= D59), F64 (≠ V60), N85 (= N87), G87 (= G89), I88 (= I90), I136 (= I140), Y151 (= Y151), K155 (= K157), P181 (= P183), G182 (= G184), I184 (≠ V186), T186 (= T188), N188 (≠ M190), T189 (≠ Q191)
3iccA Crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution (see paper)
35% identity, 98% coverage: 1:242/246 of query aligns to 4:252/255 of 3iccA
- active site: G18 (= G15), S148 (= S142), F158 (vs. gap), Y161 (= Y153), K165 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G11), S16 (≠ G13), R17 (≠ S14), G18 (= G15), I19 (= I16), H37 (vs. gap), Y38 (≠ C34), G39 (= G35), L66 (≠ D62), E67 (≠ I63), N98 (= N87), G100 (= G89), I146 (= I140), S148 (= S142), Y161 (= Y153), K165 (= K157), P191 (= P183), G192 (= G184), M198 (= M190), N199 (≠ Q191)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
35% identity, 99% coverage: 2:245/246 of query aligns to 3:239/239 of 4nbtA
- active site: G16 (= G15), S132 (= S142), Y145 (= Y153), K149 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), K15 (≠ S14), G16 (= G15), L17 (≠ I16), D36 (≠ G35), L37 (≠ R36), L52 (= L58), N53 (≠ D59), V54 (= V60), N80 (= N87), A81 (= A88), G82 (= G89), I130 (= I140), S132 (= S142), Y145 (= Y153), K149 (= K157), P177 (= P183), G178 (= G184), I180 (≠ V186), T182 (= T188)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
36% identity, 99% coverage: 1:243/246 of query aligns to 2:236/240 of 2d1yA
- active site: G16 (= G15), S135 (= S142), N145 (≠ T150), Y148 (= Y153), K152 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), R15 (≠ S14), I17 (= I16), D36 (≠ K40), L37 (= L41), R38 (≠ D42), V55 (≠ L58), D56 (= D59), L57 (≠ V60), N83 (= N87), A84 (= A88), A85 (≠ G89), I86 (= I90), V133 (≠ I140), S135 (= S142), Y148 (= Y153), K152 (= K157), P178 (= P183), G179 (= G184), I181 (≠ V186), T183 (= T188), A185 (vs. gap), V186 (≠ M190)
Q92506 (3R)-3-hydroxyacyl-CoA dehydrogenase; 17-beta-hydroxysteroid dehydrogenase 8; 17-beta-HSD 8; HSD17B8; 3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit; KAR alpha subunit; 3-oxoacyl-[acyl-carrier-protein] reductase; Estradiol 17-beta-dehydrogenase 8; Protein Ke6; Ke6; Short chain dehydrogenase/reductase family 30C member 1; Testosterone 17-beta-dehydrogenase 8; EC 1.1.1.n12; EC 1.1.1.62; EC 1.1.1.239 from Homo sapiens (Human) (see 2 papers)
29% identity, 99% coverage: 2:245/246 of query aligns to 9:261/261 of Q92506
- 15:23 (vs. 8:16, 89% identical) binding
- D42 (≠ G35) mutation to A: Reduced NADH-dependent reductase activity with acetoacetyl-CoA. Reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Increases NADPH-dependent reductase activities. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- DL 42:43 (≠ GR 35:36) binding
- ADV 74:76 (≠ LDV 58:60) binding
- R148 (≠ T132) mutation to E: No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- V158 (≠ G144) to L: in a breast cancer sample; somatic mutation
- Y169 (= Y153) mutation to A: Strongly reduced NADH-dependent reductase activity with acetoacetyl-CoA. Strongly reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Decreases NADPH-dependent reductase activity with acetoacetyl-CoA, but increases NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- YAASK 169:173 (≠ YRLSK 153:157) binding
- K173 (= K157) mutation to A: Abolishes NADH-dependent reductase activity with acetoacetyl-CoA. Strongly reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Slightly decreases NADPH-dependent reductase activity with acetoacetyl-CoA, but increases NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- R189 (≠ P173) mutation to E: No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- IAT 202:204 (≠ VAT 186:188) binding
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 99% coverage: 2:245/246 of query aligns to 3:243/244 of P0AEK2
- GASR 12:15 (≠ GGGS 11:14) binding
- T37 (≠ R36) binding
- NV 59:60 (≠ DV 59:60) binding
- N86 (= N87) binding
- Y151 (= Y153) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YRLSK 153:157) binding
- A154 (≠ S156) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K157) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ V186) binding
- E233 (≠ Q235) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
Query Sequence
>5208906 FitnessBrowser__PV4:5208906
MLKGKKILVTGGGSGIGLAIAKRALNRGASVLICGRDKIKLDNVIKEVDDSNLKMLSLDV
SDISSHKDSLEQAVQLLGGEIDILVNNAGIIDGADFLQVSEETWDRIYAVNCKGMYFLSQ
SICSRWINKGCTNGRRILNISSQGGYVAATYPYRLSKWDVVGMTQGLALKLAPLGILVNG
LAPGIVATDMQKDLVKDDTNAFLPLNPLQRHASPDEIAELAVFLVSDSCSFIVGQTIVCD
GGFILK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory