SitesBLAST
Comparing 5208917 FitnessBrowser__PV4:5208917 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
54% identity, 93% coverage: 14:298/306 of query aligns to 4:284/290 of 6knlA
- binding triphosphate: G13 (= G23), T14 (= T24), R15 (= R25), K79 (≠ R89), K81 (= K91)
- binding uridine: P8 (= P18), G11 (= G21), K25 (= K35), Q103 (= Q113), P106 (≠ A116), G108 (= G118), P130 (= P140), D131 (= D141)
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
54% identity, 93% coverage: 14:298/306 of query aligns to 4:284/290 of 6k8dA
- binding uridine-5'-diphosphate-glucose: P8 (= P18), A10 (= A20), G11 (= G21), Q103 (= Q113), P106 (≠ A116), G108 (= G118), L109 (= L119), A112 (= A122), L129 (= L139), D131 (= D141), E193 (= E207), V206 (= V220)
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
53% identity, 93% coverage: 14:298/306 of query aligns to 4:279/285 of 6ikzB
- binding uridine 5'-triphosphate: P8 (= P18), V9 (= V19), A10 (= A20), G11 (= G21), L12 (= L22), G13 (= G23), T14 (= T24), R15 (= R25), K25 (= K35), Q103 (= Q113), P106 (≠ A116), G108 (= G118), D131 (= D141)
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
49% identity, 96% coverage: 8:300/306 of query aligns to 1:285/290 of 5i1fA
- binding uridine-5'-diphosphate-glucose: P11 (= P18), A13 (= A20), G14 (= G21), K28 (= K35), E29 (= E36), Q106 (= Q113), A109 (= A116), L110 (≠ K117), G111 (= G118), L112 (= L119), A115 (= A122), D135 (≠ V142), Y172 (= Y184), G173 (= G185), E192 (= E207), K193 (= K208), V205 (= V220)
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
50% identity, 92% coverage: 14:296/306 of query aligns to 5:275/282 of 5ve7A
- binding uridine 5'-triphosphate: P9 (= P18), V10 (= V19), A11 (= A20), G12 (= G21), G14 (= G23), T15 (= T24), R16 (= R25), K26 (= K35), E27 (= E36), Q104 (= Q113), A107 (= A116), G109 (= G118), A113 (= A122)
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
44% identity, 93% coverage: 14:297/306 of query aligns to 7:280/288 of 2ux8G
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
44% identity, 89% coverage: 10:281/306 of query aligns to 6:270/281 of 8f73E
- binding uridine-5'-diphosphate-glucose: P14 (= P18), A16 (= A20), G17 (= G21), K31 (= K35), E32 (= E36), Q108 (= Q113), G113 (= G118), L114 (= L119), A117 (= A122), L134 (= L139), D137 (≠ V142), E196 (= E207), K197 (= K208), I209 (≠ V220)
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
44% identity, 89% coverage: 14:285/306 of query aligns to 4:260/264 of 3jukD
- binding magnesium ion: T14 (= T24), R15 (= R25)
- binding uridine-5'-diphosphate-glucose: P8 (= P18), A10 (= A20), G11 (= G21), E26 (= E36), Q94 (= Q113), M97 (≠ A116), G99 (= G118), L100 (= L119), A103 (= A122), L120 (= L139), D123 (≠ V142), Y162 (= Y184), G163 (= G185), E182 (= E207), K183 (= K208), V195 (= V220)
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
44% identity, 89% coverage: 14:285/306 of query aligns to 4:260/265 of 3jukA
- binding uridine-5'-diphosphate-glucose: A10 (= A20), G11 (= G21), E26 (= E36), Q94 (= Q113), M97 (≠ A116), G99 (= G118), L100 (= L119), A103 (= A122), D123 (≠ V142), Y162 (= Y184), G163 (= G185), E182 (= E207), K183 (= K208), V195 (= V220)
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
35% identity, 96% coverage: 12:306/306 of query aligns to 2:290/291 of 8b6dA
- binding uridine-5'-diphosphate: P8 (= P18), A10 (= A20), G11 (= G21), L12 (= L22), G13 (= G23), T14 (= T24), R15 (= R25), K25 (= K35), Q102 (= Q113), A105 (= A116), G107 (= G118), A111 (= A122)
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
39% identity, 95% coverage: 15:306/306 of query aligns to 6:292/299 of 2pa4B
- binding uridine-5'-diphosphate-glucose: P9 (= P18), A10 (≠ V19), A11 (= A20), G12 (= G21), E27 (= E36), Q103 (= Q113), P106 (≠ A116), G108 (= G118), L109 (= L119), L131 (= L139), P132 (= P140), D134 (= D145), Y170 (= Y184), G171 (= G185), E192 (= E207), K193 (= K208), A205 (≠ V220)
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
38% identity, 93% coverage: 14:297/306 of query aligns to 7:247/255 of 2ux8A
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
34% identity, 96% coverage: 12:306/306 of query aligns to 2:285/286 of 8b68A
- binding uridine-5'-diphosphate-glucose: P8 (= P18), A10 (= A20), G11 (= G21), Q102 (= Q113), A105 (= A116), G107 (= G118), A111 (= A122), L130 (= L139), P131 (= P140), D133 (≠ V142), A203 (≠ V220), G205 (= G222)
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
26% identity, 77% coverage: 14:249/306 of query aligns to 3:200/293 of 5ifyA
- binding 2'-deoxy-thymidine-beta-l-rhamnose: L7 (≠ P18), G9 (≠ A20), Q81 (= Q113), P84 (≠ A116), G86 (= G118), L87 (= L119), D109 (= D141), Y144 (= Y184), G145 (= G185), E160 (= E207), K161 (= K208), V171 (= V220), Y175 (= Y224), R193 (≠ G242)
- binding 2'-deoxyuridine 5'-monophosphate: Y113 (= Y147), G114 (≠ S148), H115 (≠ A149), D116 (= D150)
Sites not aligning to the query:
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
25% identity, 81% coverage: 14:261/306 of query aligns to 5:214/295 of 6n0uA
- binding 2'-deoxy-thymidine-beta-l-rhamnose: L9 (≠ P18), G11 (≠ A20), G12 (= G21), Q83 (= Q113), P86 (≠ A116), G88 (= G118), L89 (= L119), L109 (= L139), D111 (= D141), Y146 (= Y184), G147 (= G185), E162 (= E207), K163 (= K208), V173 (= V220), G175 (= G222), Y177 (= Y224), R195 (≠ G242)
5fuhA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
29% identity, 79% coverage: 14:256/306 of query aligns to 9:213/298 of 5fuhA
Sites not aligning to the query:
2ggqA Complex of hypothetical glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii
26% identity, 85% coverage: 13:273/306 of query aligns to 1:210/401 of 2ggqA
- active site: R13 (= R25)
- binding thymidine-5'-triphosphate: L6 (≠ P18), A8 (= A20), G9 (= G21), S10 (≠ L22), G11 (= G23), E12 (≠ T24), R13 (= R25), K23 (= K35), Q73 (≠ P103), G79 (= G118), A83 (= A122), R179 (≠ G242), E181 (= E244)
Sites not aligning to the query:
Q975F9 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase; EC 2.7.7.24; EC 2.7.7.9; EC 2.7.7.83; EC 2.7.7.23; EC 2.3.1.276; EC 2.3.1.157 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 3 papers)
26% identity, 85% coverage: 13:273/306 of query aligns to 1:210/401 of Q975F9
- AGSGER 8:13 (≠ AGLGTR 20:25) binding
- Q73 (≠ P103) binding
- G79 (= G118) binding
- T80 (≠ L119) mutation T->A,G,Q: Increases both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->D,H: Decrease in GlcNAc-1-P UTase activity but increase in Glc-1-P UTase activity.; mutation T->E,K,L,M,R,W,Y: Strong decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.; mutation T->F,I: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->N,S: Strong increase in GlcNAc-1-P UTase activity and decrease in Glc-1-P UTase activity.; mutation to N: Loss of GlcNAc-1-P UTase activity; when associated with V-97.
- Y97 (≠ L139) mutation Y->A,D,F,G,I,K,T,V: Increases GlcNAc-1-P UTase activity. Decreases Glc-1-P UTase activity.; mutation Y->C,E,P,R,W: Decreases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation Y->H,L,M,N,Q,S: Increases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation to V: Loss of GlcNAc-1-P UTase activity; when associated with N-80.
- E146 (= E207) mutation E->A,C,F,G,I,K,L,M,P,Q,R,V,W,Y: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->D,N: Decrease in GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->H,S,T: Decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.
Sites not aligning to the query:
- 308 H→A: Strong decrease in GalN-1-P AcTase activity and almost loss of GlcN-1-P AcTase activity.
- 311 Y→A: Strong decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 331 N→A: Strong decrease in GalN-1-P AcTase activity and decrease in GlcN-1-P AcTase activity.
- 337 K→A: Slight decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 340 K→A: Decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 391:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 38% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 16.8 times. Significantly affects the thermostability of the entire protein.
- 397:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 20% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 4.8 times. Does not affect thermostability.
5z09A St0452(y97n)-utp binding form (see paper)
26% identity, 85% coverage: 13:273/306 of query aligns to 1:210/401 of 5z09A
- binding uridine 5'-triphosphate: L6 (≠ P18), A7 (≠ V19), A8 (= A20), G9 (= G21), S10 (≠ L22), G11 (= G23), E12 (≠ T24), R13 (= R25), Q73 (≠ P103), G79 (= G118), G98 (≠ P140), D99 (= D141)
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
23% identity, 77% coverage: 13:249/306 of query aligns to 1:199/289 of 4ho4A
Sites not aligning to the query:
Query Sequence
>5208917 FitnessBrowser__PV4:5208917
MGGCLFYHIGFFMKVVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYIVNECVSAGVKE
IVLVTHASKNAIENHFDTSYELESTLEKRVKRQLLDEVQSICPKDVTIMHVRQGEAKGLG
HAVLCAKPCIGNNPFAVVLPDVILDEYSADQSSENLAAMIKHYKATQASQIMVAPVALDE
VNKYGIADCGGVNIEPGESSVIKAMVEKPAIDEAPSNLAVVGRYVLSEKIWDLLAKTPAG
AGDEIQLTDAIDMLIESDTVEAFNMTGKSHDCGDKLGYMAAFVEYGLRNEKLGKEFRQQL
DNLLAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory