Comparing 5208937 FitnessBrowser__PV4:5208937 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
59% identity, 100% coverage: 1:327/328 of query aligns to 7:342/343 of 3lzkC
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
28% identity, 71% coverage: 32:265/328 of query aligns to 23:242/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
28% identity, 71% coverage: 32:265/328 of query aligns to 23:242/280 of 6j5xA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
26% identity, 79% coverage: 48:307/328 of query aligns to 60:291/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
26% identity, 79% coverage: 48:307/328 of query aligns to 59:290/303 of 8skyB
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
28% identity, 48% coverage: 109:265/328 of query aligns to 93:243/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
28% identity, 48% coverage: 109:265/328 of query aligns to 93:243/290 of 8gsrA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
26% identity, 66% coverage: 48:265/328 of query aligns to 31:226/265 of 3r6oA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
23% identity, 59% coverage: 71:265/328 of query aligns to 54:239/269 of 4dbhA
>5208937 FitnessBrowser__PV4:5208937
MKLASYNNGRRDGQLMLVSKDLTKAVAVPAIAHTMQQLLDAWDLLQPQLQELYEALNQGV
LDNTVDFDENKCLSPLPRAYQWADGSAYVNHVELVRKARGAEMPETFWTDPLVYQGGSDS
FIAPKADIELASEEWGIDFESEVAVITDDVPMGIDAESAEKHIKLLMLVNDVSLRNLIPA
ELAKGFGFFQSKPSSSFSPVAVTPDELGDKWHESKVHLPLITHLNNELFGKPNCGIDMTF
NFSQLIAHFTKTRPLGAGAIIGSGTISNYDRSAGSSCLAETRMLETISDGKPSTSFMRFG
DRVRIEMLDENEQSIFGAIDQQVVEYKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory