Comparing 5208945 FitnessBrowser__PV4:5208945 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
100% identity, 100% coverage: 1:336/336 of query aligns to 1:336/336 of A3QCW5
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
28% identity, 89% coverage: 33:332/336 of query aligns to 4:303/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
28% identity, 89% coverage: 33:332/336 of query aligns to 4:303/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
28% identity, 89% coverage: 33:332/336 of query aligns to 4:303/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
28% identity, 89% coverage: 33:332/336 of query aligns to 4:303/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
28% identity, 89% coverage: 33:332/336 of query aligns to 5:304/310 of 7bbrA
A3T0D1 Solute-binding protein NAS141_03721 from Sulfitobacter sp. (strain NAS-14.1) (see paper)
29% identity, 97% coverage: 7:333/336 of query aligns to 1:329/330 of A3T0D1
4ovpA Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1, target efi-510292, with bound alpha-d- manuronate (see paper)
30% identity, 82% coverage: 54:330/336 of query aligns to 29:306/308 of 4ovpA
Sites not aligning to the query:
4nx1A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1, target efi-510292, with bound alpha-d- taluronate (see paper)
30% identity, 82% coverage: 54:330/336 of query aligns to 29:306/308 of 4nx1A
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
30% identity, 88% coverage: 31:325/336 of query aligns to 2:294/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
30% identity, 88% coverage: 31:325/336 of query aligns to 1:293/303 of 4p9kA
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
26% identity, 90% coverage: 17:320/336 of query aligns to 10:312/328 of Q0B2F6
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
26% identity, 80% coverage: 51:320/336 of query aligns to 17:286/301 of 4n17A
Sites not aligning to the query:
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
26% identity, 80% coverage: 51:320/336 of query aligns to 17:286/301 of 4n15A
Sites not aligning to the query:
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
27% identity, 90% coverage: 23:325/336 of query aligns to 15:315/329 of P44542
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
27% identity, 88% coverage: 34:330/336 of query aligns to 2:296/303 of 4pddA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
29% identity, 88% coverage: 34:329/336 of query aligns to 2:295/301 of 4pdhA
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
28% identity, 89% coverage: 34:331/336 of query aligns to 3:307/314 of 4p8bA
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
28% identity, 81% coverage: 55:325/336 of query aligns to 23:291/305 of 4mnpA
7t3eA Structure of the sialic acid bound tripartite atp-independent periplasmic (trap) periplasmic component siap from photobacterium profundum (see paper)
30% identity, 81% coverage: 59:329/336 of query aligns to 28:295/300 of 7t3eA
Sites not aligning to the query:
>5208945 FitnessBrowser__PV4:5208945
MTRLNTCTFIKQIVKMTSIAALLGASLNSWAAPTEIKFSHVVAENTPKGQMALKFKQLVE
ERLPGEYQVNVFPNSQLFGDNNELSALLLNDVQFVAPSLSKFERYTKKLQLFDLPFLFKD
MDAVNRFQQSDAGQQLLNSMKRKGVVGLGYLHNGMKQFSASSPLVLPEDAQGKKFRIMAS
DVLAAQFQAVEAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQSNITESNHGV
LDYMVVTSNTFWKSLPADKRKVIKASLDEAIAYGNEIAAAKVNKDKQAIIDSKRSEVTYL
TPEQRAAWVNAMKPVWAQFEDKIGKDLIDAAVASNE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory