Comparing 5209063 FitnessBrowser__PV4:5209063 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
3i6yA Structure of an esterase from the oil-degrading bacterium oleispira antarctica (see paper)
74% identity, 99% coverage: 2:276/278 of query aligns to 1:276/278 of 3i6yA
3s8yA Bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica (see paper)
74% identity, 99% coverage: 2:276/278 of query aligns to 1:276/277 of 3s8yA
P33018 S-formylglutathione hydrolase YeiG; FGH; EC 3.1.2.12 from Escherichia coli (strain K12) (see paper)
58% identity, 99% coverage: 3:276/278 of query aligns to 1:276/278 of P33018
P10768 S-formylglutathione hydrolase; FGH; Esterase D; Methylumbelliferyl-acetate deacetylase; EC 3.1.2.12; EC 3.1.1.56 from Homo sapiens (Human) (see 4 papers)
57% identity, 99% coverage: 1:276/278 of query aligns to 1:280/282 of P10768
3fcxB Crystal structure of human esterase d (see paper)
56% identity, 99% coverage: 3:276/278 of query aligns to 1:274/275 of 3fcxB
Sites not aligning to the query:
3fcxA Crystal structure of human esterase d (see paper)
57% identity, 99% coverage: 1:276/278 of query aligns to 1:266/268 of 3fcxA
Q8LAS8 S-formylglutathione hydrolase; AtSFGH; Esterase D; EC 3.1.2.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
57% identity, 99% coverage: 3:276/278 of query aligns to 5:282/284 of Q8LAS8
3e4dA Structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens (see paper)
51% identity, 97% coverage: 6:276/278 of query aligns to 5:277/278 of 3e4dA
P40363 S-formylglutathione hydrolase; FGH; EC 3.1.2.12 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
45% identity, 95% coverage: 13:276/278 of query aligns to 11:296/299 of P40363
Sites not aligning to the query:
4flmA S-formylglutathione hydrolase w197i variant containing copper (see paper)
44% identity, 95% coverage: 13:276/278 of query aligns to 11:285/288 of 4flmA
Sites not aligning to the query:
4rotA Crystal structure of esterase a from streptococcus pyogenes
26% identity, 55% coverage: 20:171/278 of query aligns to 14:153/268 of 4rotA
Sites not aligning to the query:
5volC Bacint_04212 ferulic acid esterase (see paper)
24% identity, 87% coverage: 23:264/278 of query aligns to 15:258/268 of 5volC
5cxxB Structure of a ce1 ferulic acid esterase, amce1/fae1a, from anaeromyces mucronatus in complex with ferulic acid (see paper)
27% identity, 56% coverage: 17:172/278 of query aligns to 27:181/274 of 5cxxB
Sites not aligning to the query:
7xrtA Bacteroides thetaiotaomicron ferulic acid esterase (bt_4077)
27% identity, 55% coverage: 22:173/278 of query aligns to 12:156/268 of 7xrtA
Sites not aligning to the query:
7l0aA Crystal structure of s-formylglutathione hydrolase (frmb) from staphylococcus aureus, apoenzyme (see paper)
22% identity, 53% coverage: 35:182/278 of query aligns to 37:167/249 of 7l0aA
6wcxA Fphf, staphylococcus aureus fluorophosphonate-binding serine hydrolases f, substrate bound (see paper)
22% identity, 53% coverage: 35:182/278 of query aligns to 31:161/255 of 6wcxA
Sites not aligning to the query:
6vhdA Fphf, staphylococcus aureus fluorophosphonate-binding serine hydrolases f, kt129 bound (see paper)
22% identity, 53% coverage: 35:182/278 of query aligns to 31:161/255 of 6vhdA
Sites not aligning to the query:
>5209063 FitnessBrowser__PV4:5209063
MTIENISSNKCFGGWHKQYQHQSRVLNCAMRFAIYLPPQASEQKVPVLYWLSGLTCTDEN
FMQKAGAMRIAAELGVAIVAPDTSPRGMEVADDAAYDLGQGAGFYLNATQAPWQAHYQMY
DYVVEELPELIEAHFPMTEARSLAGHSMGGHGALTIGLKHPDRYRSVSAFSPIVNPINCP
WGQKAFTEYLGKNRDAWLAYDACELMKQASCDLPIFIDQGSSDNFLEEQLRPEALIAVAK
EKEYPLILRMQEGYDHSYYFIATFIEDHLRFHAKYLYD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory