Comparing 5209141 FitnessBrowser__PV4:5209141 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3n2oB X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
68% identity, 98% coverage: 13:635/637 of query aligns to 8:629/629 of 3n2oB
3n2oA X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
68% identity, 98% coverage: 13:635/637 of query aligns to 9:630/630 of 3n2oA
3nzqA Crystal structure of biosynthetic arginine decarboxylase adc (spea) from escherichia coli, northeast structural genomics consortium target er600 (see paper)
56% identity, 98% coverage: 13:635/637 of query aligns to 6:624/628 of 3nzqA
Q9SI64 Arginine decarboxylase 1, chloroplastic; ADC 1; ADC-O; ARGDC 1; AtADC1; EC 4.1.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 97% coverage: 3:618/637 of query aligns to 33:632/702 of Q9SI64
3nzpB Crystal structure of the biosynthetic arginine decarboxylase spea from campylobacter jejuni, northeast structural genomics consortium target br53 (see paper)
32% identity, 98% coverage: 13:634/637 of query aligns to 4:579/591 of 3nzpB
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
24% identity, 41% coverage: 95:356/637 of query aligns to 38:274/394 of 3c5qA
Sites not aligning to the query:
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
24% identity, 41% coverage: 95:356/637 of query aligns to 40:276/405 of B4XMC6
Sites not aligning to the query:
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
27% identity, 28% coverage: 176:355/637 of query aligns to 133:306/434 of 1twiA
Sites not aligning to the query:
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
27% identity, 28% coverage: 176:355/637 of query aligns to 137:310/438 of Q58497
Sites not aligning to the query:
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
27% identity, 28% coverage: 176:355/637 of query aligns to 133:306/434 of 1tufA
Sites not aligning to the query:
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
25% identity, 43% coverage: 80:355/637 of query aligns to 43:289/418 of 4xg1B
Sites not aligning to the query:
7kh2D Structure of n-citrylornithine decarboxylase bound with plp (see paper)
25% identity, 45% coverage: 81:368/637 of query aligns to 46:313/415 of 7kh2D
Sites not aligning to the query:
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
25% identity, 38% coverage: 124:364/637 of query aligns to 65:294/412 of 7ru7A
Sites not aligning to the query:
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
26% identity, 28% coverage: 175:355/637 of query aligns to 107:283/419 of 1ko0A
Sites not aligning to the query:
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
26% identity, 28% coverage: 175:355/637 of query aligns to 108:284/420 of P00861
Sites not aligning to the query:
1knwA Crystal structure of diaminopimelate decarboxylase
26% identity, 28% coverage: 175:355/637 of query aligns to 107:283/421 of 1knwA
Sites not aligning to the query:
6knhC Crystal structure of sbnh in complex with citrate, a plp-dependent decarboxylase in staphyloferrin b biothesynthesis (see paper)
25% identity, 42% coverage: 92:356/637 of query aligns to 40:273/384 of 6knhC
Sites not aligning to the query:
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
21% identity, 46% coverage: 98:387/637 of query aligns to 60:327/422 of 6n2aA
Sites not aligning to the query:
5gjnA Crystal structure of lysine decarboxylase from selenomonas ruminantium in p43212 space group (see paper)
23% identity, 22% coverage: 219:359/637 of query aligns to 140:264/369 of 5gjnA
Sites not aligning to the query:
5gjpA Crystal structure of srldc in complex with plp and cadaverine (see paper)
23% identity, 22% coverage: 220:359/637 of query aligns to 142:267/381 of 5gjpA
Sites not aligning to the query:
>5209141 FitnessBrowser__PV4:5209141
MSNWSIKDAYVGYNVNYWSSGLYGISEAGEVTVSPDPNHPEHTIGLNELAKDMVKSGVAL
PVLVRFPQILHHRVNSLCNAFNQAITRYDYQSDYLLVYPIKVNQQQTVVEEILASQVSKE
VPQLGLEAGSKPELMAVLAMAQKASSVIICNGYKDVEYIRLALIGEKLGHQVYIVLEKLS
ELKVVLEEAKKLGVTPRLGLRVRLAFQGKGKWQASGGEKSKFGLSAAQVLNVINSLKDED
MLDSLQLLHFHLGSQIANIRDIRSGVSEAGRFYCELQKMGANVKCFDVGGGLAVDYDGTR
SQSSNSMNYGLTEYANNIVSVLNDMCREHDQPMPRLISESGRYLTAHHAVLITDVIGTEA
YKPEDLQAPDEEAPQQLKNMWDSWGEVSGRADQRALIEIYHDVQSDLAEVHSLFALGQMS
LSDRAWAEQMNLRVCYELKGVMSGKYRFHRPVIDELNEKLADKFFVNFSLFQSLPDAWGI
DQVFPVMPLSGLDKKPERRAVMLDITCDSDGTVDQYVDGQGIETTLPVPAWSAESPYLIG
FFLVGAYQEILGDMHNLFGDTNSAVVRLDDDGLVNIESVLAGDTVADVLRYVNLDAVSFM
RTYEELVNLHIQEDERANILEELQIGLKGYTYLEDFS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory