Comparing 5209143 FitnessBrowser__PV4:5209143 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
63% identity, 98% coverage: 1:302/307 of query aligns to 1:301/306 of P60651
7lbaB E. Coli agmatinase (see paper)
63% identity, 98% coverage: 1:302/307 of query aligns to 8:308/310 of 7lbaB
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
64% identity, 95% coverage: 11:302/307 of query aligns to 1:291/294 of 7lolA
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
62% identity, 94% coverage: 15:302/307 of query aligns to 1:281/284 of 7loxA
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
50% identity, 85% coverage: 41:301/307 of query aligns to 54:315/323 of 4dz4B
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
39% identity, 92% coverage: 20:300/307 of query aligns to 24:312/319 of Q9I3S3
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
39% identity, 92% coverage: 20:300/307 of query aligns to 21:309/316 of 3nioA
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
39% identity, 96% coverage: 13:306/307 of query aligns to 12:310/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
39% identity, 95% coverage: 13:305/307 of query aligns to 4:301/301 of 1gq6B
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
40% identity, 87% coverage: 35:302/307 of query aligns to 35:309/316 of 3nipB
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
40% identity, 87% coverage: 35:302/307 of query aligns to 34:308/315 of 3niqA
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
40% identity, 87% coverage: 35:302/307 of query aligns to 37:311/318 of Q9I6K2
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
33% identity, 83% coverage: 34:288/307 of query aligns to 76:341/378 of 7esrA
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
30% identity, 87% coverage: 31:298/307 of query aligns to 19:280/284 of Q57757
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
28% identity, 87% coverage: 31:297/307 of query aligns to 3:267/276 of 3lhlA
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
30% identity, 90% coverage: 32:307/307 of query aligns to 22:287/293 of 3pzlB
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
30% identity, 95% coverage: 8:298/307 of query aligns to 2:295/303 of 1wogA
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
31% identity, 87% coverage: 31:297/307 of query aligns to 37:312/318 of 6vsuE
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 87% coverage: 31:297/307 of query aligns to 61:336/342 of P46637
Sites not aligning to the query:
6vstA Arginase from medicago truncatula in complex with ornithine (see paper)
31% identity, 85% coverage: 37:297/307 of query aligns to 42:311/317 of 6vstA
>5209143 FitnessBrowser__PV4:5209143
MTTIADKPDYSLYSNAFGYLRQPLDFKPLESDADVVVIGLPFDMATTGRSGGRMGPGAIR
QASVNLAWEECRWPWDFKLSDHLKMVDAGDLVFDCGDAADFTQRVEDFATAVLDSGKALM
SFGGDHFVTLPLLRAHYKKHGKMALLHFDAHTDTYSQGSKYDHGTMFFHAPNEGIIDASH
SVQVGIRTEYDKPSHLFKVIDAAAANEMTADEIVAQIKDRVGDMPLYVTFDIDCLDPAFA
PGTGTPVCGGLTSDKAMKIIRGLRGMNVVGMDVVEVAPAYDSAEITALAGATLGLEMLHV
WACAHKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory