Comparing 5209172 FitnessBrowser__PV4:5209172 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0ABH7 Citrate synthase; EC 2.3.3.16 from Escherichia coli (strain K12) (see 2 papers)
74% identity, 100% coverage: 1:428/428 of query aligns to 1:427/427 of P0ABH7
1owbA Three dimensional structure analysis of the variant r109l nadh complex of type ii citrate synthase from e. Coli (see paper)
74% identity, 100% coverage: 2:428/428 of query aligns to 1:426/426 of 1owbA
4jagA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with oxaloacetate (see paper)
74% identity, 100% coverage: 2:428/428 of query aligns to 1:426/426 of 4jagA
4jaeA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with s- carboxymethyl-coa (see paper)
74% identity, 100% coverage: 2:428/428 of query aligns to 1:426/426 of 4jaeA
1nxgA The f383a variant of type ii citrate synthase complexed with nadh (see paper)
74% identity, 100% coverage: 2:428/428 of query aligns to 1:426/426 of 1nxgA
2h12B Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
68% identity, 97% coverage: 15:428/428 of query aligns to 11:426/426 of 2h12B
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
55% identity, 100% coverage: 2:428/428 of query aligns to 4:431/431 of P9WPD5
3msuB Crystal structure of citrate synthase from francisella tularensis
54% identity, 96% coverage: 13:422/428 of query aligns to 20:426/426 of 3msuB
3msuA Crystal structure of citrate synthase from francisella tularensis
52% identity, 96% coverage: 13:422/428 of query aligns to 20:415/415 of 3msuA
4tvmA Structure of citrate synthase from mycobacterium tuberculosis (see paper)
50% identity, 98% coverage: 6:425/428 of query aligns to 2:380/380 of 4tvmA
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
37% identity, 87% coverage: 55:428/428 of query aligns to 8:369/369 of 6abwA
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
33% identity, 89% coverage: 46:428/428 of query aligns to 6:370/370 of 6abxA
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
33% identity, 89% coverage: 46:428/428 of query aligns to 6:370/372 of 6abyA
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
33% identity, 88% coverage: 54:428/428 of query aligns to 12:370/371 of 1aj8A
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
36% identity, 88% coverage: 53:428/428 of query aligns to 11:371/371 of 1ixeA
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
36% identity, 88% coverage: 53:428/428 of query aligns to 11:374/374 of 1iomA
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
35% identity, 89% coverage: 46:428/428 of query aligns to 9:371/372 of P39120
6s87D Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
32% identity, 89% coverage: 46:428/428 of query aligns to 1:365/365 of 6s87D
4yboB Structure of citrate synthase from the thermoacidophilic euryarchaeon thermolasma acidophilum (see paper)
31% identity, 87% coverage: 55:428/428 of query aligns to 15:380/381 of 4yboB
2ifcC The structure of the binary complex of oxalateacetate with citrate synthase from the thermophilic archaeon thermolasma acidophilum
31% identity, 87% coverage: 55:428/428 of query aligns to 16:381/382 of 2ifcC
>5209172 FitnessBrowser__PV4:5209172
MADNIAKLELPGNDSIDLPIKKGTAGFDVIDISKLGSKGHFTFDPGFLATASCESAITYI
DGAQGILLHRGYAIDELAVDSDYLDLCYLLLYGELPNKAQYDKFVYTVKTHTMVNEQLAS
FFRGFRRDAHPMAMLCGVTGALSAFYQDSLDVNDEHHREIAAFRLVSKMPTIAAMCYKYS
IGQPFVYPRNDLSYAGNFLSMMFAVPCEEYKVNPIIERAMDRIFILHADHEQNASTSTVR
LAGSSGANPFACIAAGIASLWGPAHGGANEACLNMLEEIGTVDRIPEFIARAKDKEDPFR
LMGFGHRVYKNFDPRAKVMRETCHEVLAELKVDDPLLDVAMELERIALEDEYFVSKKLYP
NVDFYSGIIMKAIGIPTSMFTVLFALARTVGWIAHWKEMLDQPGHKISRPRQLYTGSPER
DFVKLDKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory