SitesBLAST
Comparing 5209240 FitnessBrowser__PV4:5209240 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
61% identity, 93% coverage: 5:421/446 of query aligns to 2:417/429 of P12995
- Y17 (= Y20) mutation to F: Severely reduces the aminotransferase activity.
- W52 (= W55) binding
- GS 112:113 (= GS 115:116) binding
- Y144 (= Y148) mutation to F: Severely reduces the aminotransferase activity.
- D147 (= D151) mutation to N: Loss of aminotransferase activity.
- D245 (= D249) binding
- R253 (= R257) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K278) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (= G311) binding
- PT 308:309 (= PT 312:313) binding
- R391 (= R395) binding ; mutation to A: Reduces aminotransferase activity.
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
61% identity, 93% coverage: 5:421/446 of query aligns to 2:417/429 of 6ed7A
- active site: Y17 (= Y20), Y144 (= Y148), D245 (= D249), K274 (= K278)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (= Y20), W52 (= W55), W52 (= W55), Y144 (= Y148), D147 (= D151), A217 (= A221), K274 (= K278), R391 (= R395), F393 (= F397), F393 (= F397)
- binding pyridoxal-5'-phosphate: G112 (= G115), S113 (= S116), Y144 (= Y148), H145 (= H149), D245 (= D249), I247 (= I251), K274 (= K278)
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
61% identity, 93% coverage: 5:421/446 of query aligns to 2:416/427 of 1mlzA
- active site: Y17 (= Y20), Y144 (= Y148), E210 (= E215), D244 (= D249), A247 (= A252), K273 (= K278), Y397 (= Y402)
- binding pyridoxal-5'-phosphate: G112 (= G115), S113 (= S116), Y144 (= Y148), H145 (= H149), D244 (= D249), I246 (= I251), K273 (= K278), P307 (= P312), T308 (= T313)
- binding trans-amiclenomycin: W52 (= W55), W53 (= W56), Y144 (= Y148), K273 (= K278), R390 (= R395), F392 (= F397)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
61% identity, 93% coverage: 5:421/446 of query aligns to 2:416/427 of 1mlyA
- active site: Y17 (= Y20), Y144 (= Y148), E210 (= E215), D244 (= D249), A247 (= A252), K273 (= K278), Y397 (= Y402)
- binding cis-amiclenomycin: W52 (= W55), W53 (= W56), K273 (= K278), R390 (= R395), F392 (= F397)
- binding pyridoxal-5'-phosphate: G112 (= G115), S113 (= S116), Y144 (= Y148), H145 (= H149), D244 (= D249), I246 (= I251), K273 (= K278), P307 (= P312), T308 (= T313)
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
60% identity, 93% coverage: 5:421/446 of query aligns to 2:417/429 of 1dtyA
- active site: Y17 (= Y20), Y144 (= Y148), E211 (= E215), D245 (= D249), A248 (= A252), K274 (= K278), Y398 (= Y402)
- binding pyridoxal-5'-phosphate: G112 (= G115), S113 (= S116), Y144 (= Y148), H145 (= H149), D245 (= D249), I247 (= I251), K274 (= K278)
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
60% identity, 93% coverage: 5:421/446 of query aligns to 2:405/416 of 1qj3A
- active site: Y17 (= Y20), Y144 (= Y148), E201 (= E215), D235 (= D249), A238 (= A252), K264 (= K278), Y386 (= Y402)
- binding 7-keto-8-aminopelargonic acid: Y17 (= Y20), W52 (= W55), Y144 (= Y148), K264 (= K278), R379 (= R395), F381 (= F397)
- binding pyridoxal-5'-phosphate: G112 (= G115), S113 (= S116), Y144 (= Y148), H145 (= H149), G146 (= G150), D235 (= D249), I237 (= I251), A238 (= A252), K264 (= K278)
6erkA Crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis (see paper)
51% identity, 95% coverage: 4:426/446 of query aligns to 2:414/420 of 6erkA
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 10:427/427 of 4cxqA
- active site: Y18 (= Y20), Y149 (= Y148), E212 (= E215), D246 (= D249), A249 (= A252), K275 (= K278), Y399 (= Y402)
- binding 7-keto-8-aminopelargonic acid: W56 (= W55), Y149 (= Y148), G308 (= G311), T310 (= T313), R392 (= R395)
- binding pyridoxal-5'-phosphate: G116 (= G115), S117 (= S116), Y149 (= Y148), H150 (= H149), G151 (= G150), E212 (= E215), D246 (= D249), I248 (= I251), K275 (= K278), P309 (= P312), T310 (= T313)
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 10:425/425 of 4w1vA
- active site: Y18 (= Y20), Y147 (= Y148), E210 (= E215), D244 (= D249), A247 (= A252), K273 (= K278), Y397 (= Y402)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P19), Y18 (= Y20), W54 (= W55), M81 (= M82), G83 (= G84), Y147 (= Y148), G306 (= G311), P307 (= P312), T308 (= T313), F392 (= F397)
- binding pyridoxal-5'-phosphate: G114 (= G115), S115 (= S116), Y147 (= Y148), H148 (= H149), E210 (= E215), D244 (= D249), I246 (= I251), K273 (= K278)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 10:425/425 of 4cxrA
- active site: Y18 (= Y20), Y147 (= Y148), E210 (= E215), D244 (= D249), A247 (= A252), K273 (= K278), Y397 (= Y402)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (= Y20), W54 (= W55), W55 (= W56), A216 (= A221)
- binding pyridoxal-5'-phosphate: G114 (= G115), S115 (= S116), Y147 (= Y148), H148 (= H149), E210 (= E215), D244 (= D249), I246 (= I251), K273 (= K278), P307 (= P312), T308 (= T313)
P9WQ81 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; 7,8-diaminopelargonic acid synthase; DAPAS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 17:435/437 of P9WQ81
- Y25 (= Y20) mutation to A: Does not show detectable activity at 335 nm with SAM, even up to concentrations of 3 mM, and shows approximately 70% reduced activity with high concentrations of DAPA (0.5 mM).
- W64 (= W55) binding
- Y157 (= Y148) binding
- K283 (= K278) modified: N6-(pyridoxal phosphate)lysine
- G316 (= G311) binding
5te2A Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a mechanism-based inhibitor (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 10:428/428 of 5te2A
- active site: Y18 (= Y20), Y150 (= Y148), E213 (= E215), D247 (= D249), A250 (= A252), K276 (= K278), Y400 (= Y402)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-4-oxo-1,4-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: Y18 (= Y20), W57 (= W55), G117 (= G115), S118 (= S116), Y150 (= Y148), H151 (= H149), G152 (= G150), D247 (= D249), I249 (= I251), K276 (= K278), G309 (= G311), P310 (= P312), T311 (= T313)
4xjoA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 10:428/428 of 4xjoA
- active site: Y18 (= Y20), Y150 (= Y148), E213 (= E215), D247 (= D249), A250 (= A252), K276 (= K278), Y400 (= Y402)
- binding 5-[4-(3-chlorobenzoyl)piperazin-1-yl]-1H-inden-1-one: P17 (= P19), Y18 (= Y20), W57 (= W55), M84 (= M82), G86 (= G84), Y150 (= Y148), G165 (= G163), G166 (= G164), A219 (= A221), P310 (= P312), T311 (= T313)
- binding pyridoxal-5'-phosphate: G117 (= G115), S118 (= S116), Y150 (= Y148), H151 (= H149), G152 (= G150), E213 (= E215), D247 (= D249), I249 (= I251), K276 (= K278), P310 (= P312), T311 (= T313)
4xewA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 10:428/428 of 4xewA
- active site: Y18 (= Y20), Y150 (= Y148), E213 (= E215), D247 (= D249), A250 (= A252), K276 (= K278), Y400 (= Y402)
- binding 6-(2-fluorophenyl)[1,3]dioxolo[4,5-g]quinolin-8(5H)-one: P17 (= P19), Y18 (= Y20), W57 (= W55), Y150 (= Y148), P310 (= P312), T311 (= T313), R393 (= R395), F395 (= F397)
- binding pyridoxal-5'-phosphate: G117 (= G115), S118 (= S116), Y150 (= Y148), H151 (= H149), G152 (= G150), E213 (= E215), D247 (= D249), I249 (= I251), K276 (= K278), P310 (= P312), T311 (= T313)
4wyfA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a dsf fragment hit (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 10:428/428 of 4wyfA
- active site: Y18 (= Y20), Y150 (= Y148), E213 (= E215), D247 (= D249), A250 (= A252), K276 (= K278), Y400 (= Y402)
- binding N-(1-oxo-1H-inden-5-yl)acetamide: M84 (= M82), G86 (= G84), G309 (= G311), P310 (= P312), T311 (= T313)
- binding pyridoxal-5'-phosphate: G117 (= G115), S118 (= S116), Y150 (= Y148), H151 (= H149), G152 (= G150), E213 (= E215), D247 (= D249), I249 (= I251), K276 (= K278), P310 (= P312), T311 (= T313)
4wycA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole benzamide inhibitor (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 10:428/428 of 4wycA
- active site: Y18 (= Y20), Y150 (= Y148), E213 (= E215), D247 (= D249), A250 (= A252), K276 (= K278), Y400 (= Y402)
- binding 4-(1H-imidazol-1-yl)benzamide: P17 (= P19), Y18 (= Y20), W57 (= W55), M84 (= M82), G86 (= G84), Y150 (= Y148), G309 (= G311)
- binding pyridoxal-5'-phosphate: G117 (= G115), S118 (= S116), Y150 (= Y148), H151 (= H149), G152 (= G150), E213 (= E215), D247 (= D249), I249 (= I251), K276 (= K278), P310 (= P312), T311 (= T313)
4mqrA Mycobaterium tuberculosis transaminase bioa complexed with e)-5- hydroxy-4-(((z)-isonicotinoyldiazenyl)methylene)-6-methyl-1,4- dihydropyridin-3-yl)methyl phosphate (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 10:428/428 of 4mqrA
- active site: Y18 (= Y20), Y150 (= Y148), E213 (= E215), D247 (= D249), A250 (= A252), K276 (= K278), Y400 (= Y402)
- binding [(4Z)-5-hydroxy-6-methyl-4-{[(E)-(pyridin-4-ylcarbonyl)diazenyl]methylidene}-1,4-dihydropyridin-3-yl]methyl dihydrogen phosphate: Y18 (= Y20), W57 (= W55), G117 (= G115), S118 (= S116), Y150 (= Y148), H151 (= H149), D247 (= D249), I249 (= I251), K276 (= K278), G309 (= G311), P310 (= P312), T311 (= T313)
4mqqA Mycobaterium tuberculosis transaminase bioa complexed with benzo[d]thiazole-2-carbohydrazide (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 10:428/428 of 4mqqA
- active site: Y18 (= Y20), Y150 (= Y148), E213 (= E215), D247 (= D249), A250 (= A252), K276 (= K278), Y400 (= Y402)
- binding (4-{[(E)-(1,3-benzothiazol-2-ylcarbonyl)diazenyl]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: Y18 (= Y20), W57 (= W55), W58 (= W56), G117 (= G115), S118 (= S116), Y150 (= Y148), H151 (= H149), D247 (= D249), I249 (= I251), K276 (= K278), P310 (= P312), T311 (= T313)
4mqpA Mycobaterium tuberculosis transaminase bioa complexed with 2- hydrazinylbenzo[d]thiazole (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 10:428/428 of 4mqpA
- active site: Y18 (= Y20), Y150 (= Y148), E213 (= E215), D247 (= D249), A250 (= A252), K276 (= K278), Y400 (= Y402)
- binding (4-{[(E)-1,3-benzothiazol-2-yldiazenyl]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: W57 (= W55), W58 (= W56), G117 (= G115), S118 (= S116), Y150 (= Y148), H151 (= H149), E213 (= E215), A219 (= A221), D247 (= D249), I249 (= I251), K276 (= K278), Y400 (= Y402)
5kgtA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1- yl]phenyl]ethanone (see paper)
49% identity, 94% coverage: 12:430/446 of query aligns to 10:428/429 of 5kgtA
- active site: Y18 (= Y20), Y150 (= Y148), E213 (= E215), D247 (= D249), A250 (= A252), K276 (= K278), Y400 (= Y402)
- binding 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1-yl]phenyl]ethanone: M84 (= M82), G86 (= G84), G309 (= G311), T311 (= T313)
- binding pyridoxal-5'-phosphate: S116 (= S114), G117 (= G115), S118 (= S116), Y150 (= Y148), H151 (= H149), G152 (= G150), E213 (= E215), D247 (= D249), I249 (= I251), K276 (= K278)
Query Sequence
>5209240 FitnessBrowser__PV4:5209240
MSATTQIDHQFDRQHIWHPYTSMTQALPVYGVVSAEGCELILDDGRRLIDGTSSWWACVH
GYGHPYILEAMQKQLSTLSHVMFGGITHPSAIAVSKKLLAMTSDNLTKVFLADSGSIAVE
VAMKMALQYWQGRGAPSKQRILTVKHGYHGDTFAAMSVCDPEGGMHTMFGEAVTQQLFAP
APKTPFGETLIADDLEAMEALLNAHHQTIAAVIIEPIMQGAGAMHFYSADYLKGLRALCD
RYKVLLILDEIATGFGRTGKLFAYQHAGIEADILCLGKALTGGYISLAATLCSDEVALGI
SDSPSGVFMHGPTFMGNPLACAAASASLDLINQHQWPEQVAAIEQQMKQELATASAIEGV
KAVRCLGAVGVIEMTRSVNTAALQQAFVDRGVWVRPFSSYIYIMPPYTISAQQLSRLTQA
MLEVAAIAGAEAKASRGDEASFISHG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory