Comparing 5209266 FitnessBrowser__PV4:5209266 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
8gxkB Pseudomonas jinjuensis n-acetyltransferase (see paper)
40% identity, 87% coverage: 17:191/201 of query aligns to 15:183/188 of 8gxkB
8gxfB Pseudomonas flexibilis gcn5 family acetyltransferase (see paper)
35% identity, 88% coverage: 15:191/201 of query aligns to 13:183/187 of 8gxfB
1yreB Hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
39% identity, 87% coverage: 17:191/201 of query aligns to 15:183/187 of 1yreB
>5209266 FitnessBrowser__PV4:5209266
MSQDALRGCLSGERVVLEPLQEEHIPALSIAVSDGELWNLWYTSAPHPDEMKTYVEQALA
SEQRGEALAFAVRDRHSGEIVGCTRLMSWDQTHRRIEIGHTWYAKSAQRTGVNSECKLLL
LTYAFETLDVIAVEFRTHWHNQRSREAITRLGAKQDGVLRNHRILKDGTIRDTVVYSIIA
SEWPSVKQNLKFRMRQYLENQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory