SitesBLAST
Comparing 5209298 FitnessBrowser__PV4:5209298 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
41% identity, 98% coverage: 2:565/573 of query aligns to 92:657/667 of P09342
- C161 (≠ V71) modified: Disulfide link with 307
- P194 (= P104) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ A217) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
41% identity, 98% coverage: 2:565/573 of query aligns to 89:654/664 of P09114
- P191 (= P104) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W485) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
43% identity, 98% coverage: 4:565/573 of query aligns to 8:568/591 of 5wkcA
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (≠ S29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R222 (≠ Q225), M258 (= M260), V285 (≠ T287), V401 (= V396), L426 (= L421), G427 (= G422), M429 (= M424), D454 (= D449), N481 (= N476), E483 (≠ F478), Q484 (≠ L479), M486 (= M481), V487 (= V482), W490 (= W485), L512 (≠ I508), G517 (= G513), L518 (≠ H514), K551 (≠ E548)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (= V396), G402 (= G397), Q403 (= Q398), H404 (= H399), G427 (= G422), M429 (= M424), G453 (= G448), D454 (= D449), A455 (≠ G450), S456 (= S451), M459 (= M454), N481 (= N476), E483 (≠ F478), Q484 (≠ L479), G485 (= G480), M486 (= M481), V487 (= V482)
- binding ethaneperoxoic acid: G32 (= G28), Q118 (= Q114)
- binding flavin-adenine dinucleotide: R157 (= R153), G211 (= G214), A212 (≠ G215), G213 (= G216), N216 (≠ I219), T238 (= T240), L239 (= L241), Q240 (≠ M242), L256 (= L258), M258 (= M260), G278 (= G280), A279 (≠ V281), R280 (= R282), R284 (= R286), V285 (≠ T287), E311 (≠ D304), V312 (≠ I305), N316 (≠ S309), D330 (≠ S323), A331 (= A324), M406 (= M401), G424 (= G419)
- binding magnesium ion: D454 (= D449), N481 (= N476), E483 (≠ F478)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (= G28), A33 (≠ S29), V107 (= V103), F117 (= F113), K167 (= K163), M258 (= M260), R284 (= R286), M486 (= M481), W490 (= W485)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P26), E55 (= E51)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
43% identity, 98% coverage: 4:565/573 of query aligns to 8:573/596 of 1t9cA
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (≠ S29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R227 (≠ Q225), M263 (= M260), V290 (≠ T287), V406 (= V396), L431 (= L421), G432 (= G422), M434 (= M424), D459 (= D449), N486 (= N476), E488 (≠ F478), Q489 (≠ L479), M491 (= M481), V492 (= V482), W495 (= W485), L517 (≠ I508), G522 (= G513), L523 (≠ H514), K556 (≠ E548)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G28), V107 (= V103), P108 (= P104), F117 (= F113), K167 (= K163), D288 (= D285), R289 (= R286), W495 (= W485)
- binding flavin-adenine dinucleotide: R157 (= R153), G216 (= G214), A217 (≠ G215), G218 (= G216), N221 (≠ I219), T243 (= T240), L244 (= L241), Q245 (≠ M242), L261 (= L258), M263 (= M260), H264 (= H261), G283 (= G280), A284 (≠ V281), R285 (= R282), D287 (= D284), R289 (= R286), V290 (≠ T287), E316 (≠ D304), V317 (≠ I305), N321 (≠ S309), G334 (= G322), D335 (≠ S323), A336 (= A324), M411 (= M401), G429 (= G419), G430 (= G420)
- binding magnesium ion: D459 (= D449), N486 (= N476), E488 (≠ F478)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
41% identity, 98% coverage: 6:565/573 of query aligns to 99:660/670 of P17597
- A122 (≠ S29) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L31) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E51) binding
- S186 (= S93) binding
- P197 (= P104) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ N106) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q114) binding
- K220 (= K127) binding
- R246 (= R153) binding ; binding
- K256 (= K163) binding
- G308 (= G215) binding
- TL 331:332 (= TL 240:241) binding
- C340 (≠ G249) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 258:261) binding
- GVRFD 371:375 (= GVRFD 280:284) binding
- DR 376:377 (= DR 285:286) binding
- DI 395:396 (= DI 304:305) binding
- DV 414:415 (≠ SA 323:324) binding
- QH 487:488 (= QH 398:399) binding
- GG 508:509 (= GG 419:420) binding
- GAM 511:513 (≠ GTM 422:424) binding
- D538 (= D449) binding
- DGS 538:540 (= DGS 449:451) binding
- N565 (= N476) binding
- NQHLGM 565:570 (≠ NRFLGM 476:481) binding
- H567 (≠ F478) binding
- W574 (= W485) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ R558) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
43% identity, 98% coverage: 4:565/573 of query aligns to 10:576/599 of 1n0hA
- active site: Y31 (= Y25), G33 (= G27), G34 (= G28), A35 (≠ S29), I36 (≠ V30), E57 (= E51), T80 (= T74), F119 (= F113), Q120 (= Q114), E121 (= E115), K169 (= K163), R230 (≠ Q225), M266 (= M260), V293 (≠ T287), V409 (= V396), L434 (= L421), G435 (= G422), M437 (= M424), D462 (= D449), N489 (= N476), E491 (≠ F478), Q492 (≠ L479), M494 (= M481), V495 (= V482), W498 (= W485), L520 (≠ I508), G525 (= G513), L526 (≠ H514), K559 (≠ E548)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (= V396), G410 (= G397), Q411 (= Q398), H412 (= H399), G435 (= G422), M437 (= M424), G461 (= G448), D462 (= D449), A463 (≠ G450), S464 (= S451), M467 (= M454), N489 (= N476), E491 (≠ F478), Q492 (≠ L479), G493 (= G480), V495 (= V482)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (= G28), A35 (≠ S29), V109 (= V103), P110 (= P104), F119 (= F113), K169 (= K163), M266 (= M260), D291 (= D285), R292 (= R286), V495 (= V482), W498 (= W485)
- binding flavin-adenine dinucleotide: R159 (= R153), G219 (= G214), A220 (≠ G215), G221 (= G216), N224 (≠ I219), T246 (= T240), L247 (= L241), Q248 (≠ M242), L264 (= L258), G265 (= G259), M266 (= M260), H267 (= H261), G286 (= G280), A287 (≠ V281), R288 (= R282), D290 (= D284), R292 (= R286), V293 (≠ T287), E319 (≠ D304), V320 (≠ I305), N324 (≠ S309), G337 (= G322), D338 (≠ S323), A339 (= A324), M414 (= M401), G432 (= G419), G433 (= G420)
- binding magnesium ion: D462 (= D449), N489 (= N476), E491 (≠ F478)
- binding thiamine diphosphate: Y31 (= Y25), E57 (= E51), P83 (= P77)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
43% identity, 98% coverage: 4:565/573 of query aligns to 9:574/597 of 1t9aA
- active site: Y30 (= Y25), G32 (= G27), G33 (= G28), A34 (≠ S29), I35 (≠ V30), E56 (= E51), T79 (= T74), F118 (= F113), Q119 (= Q114), E120 (= E115), K168 (= K163), R228 (≠ Q225), M264 (= M260), V291 (≠ T287), V407 (= V396), L432 (= L421), G433 (= G422), M435 (= M424), D460 (= D449), N487 (= N476), E489 (≠ F478), Q490 (≠ L479), M492 (= M481), V493 (= V482), W496 (= W485), L518 (≠ I508), G523 (= G513), L524 (≠ H514), K557 (≠ E548)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (= G28), V108 (= V103), P109 (= P104), F118 (= F113), K168 (= K163), M264 (= M260), D289 (= D285), R290 (= R286), M492 (= M481), V493 (= V482), W496 (= W485)
- binding flavin-adenine dinucleotide: R158 (= R153), G217 (= G214), A218 (≠ G215), G219 (= G216), N222 (≠ I219), T244 (= T240), L245 (= L241), Q246 (≠ M242), L262 (= L258), M264 (= M260), H265 (= H261), G284 (= G280), A285 (≠ V281), R286 (= R282), D288 (= D284), R290 (= R286), V291 (≠ T287), E317 (≠ D304), V318 (≠ I305), N322 (≠ S309), G335 (= G322), D336 (≠ S323), A337 (= A324), Q411 (= Q400), M412 (= M401), G430 (= G419), G431 (= G420)
- binding magnesium ion: D460 (= D449), N487 (= N476), E489 (≠ F478)
- binding propyl trihydrogen diphosphate: V407 (= V396), G408 (= G397), Q409 (= Q398), H410 (= H399), M435 (= M424), G459 (= G448), D460 (= D449), A461 (≠ G450), S462 (= S451), N487 (= N476), E489 (≠ F478), Q490 (≠ L479), G491 (= G480), M492 (= M481)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G422), M435 (= M424), M465 (= M454)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
43% identity, 98% coverage: 4:565/573 of query aligns to 8:573/596 of 1t9dA
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (≠ S29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R227 (≠ Q225), M263 (= M260), V290 (≠ T287), V406 (= V396), L431 (= L421), G432 (= G422), M434 (= M424), D459 (= D449), N486 (= N476), E488 (≠ F478), Q489 (≠ L479), M491 (= M481), V492 (= V482), W495 (= W485), L517 (≠ I508), G522 (= G513), L523 (≠ H514), K556 (≠ E548)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G28), A33 (≠ S29), V107 (= V103), P108 (= P104), F117 (= F113), K167 (= K163), M263 (= M260), D288 (= D285), R289 (= R286), W495 (= W485)
- binding flavin-adenine dinucleotide: R157 (= R153), G216 (= G214), A217 (≠ G215), G218 (= G216), N221 (≠ I219), T243 (= T240), L244 (= L241), Q245 (≠ M242), M260 (= M257), L261 (= L258), H264 (= H261), G283 (= G280), A284 (≠ V281), R285 (= R282), D287 (= D284), R289 (= R286), V290 (≠ T287), E316 (≠ D304), V317 (≠ I305), N321 (≠ S309), G334 (= G322), D335 (≠ S323), A336 (= A324), Q410 (= Q400), M411 (= M401), G429 (= G419), G430 (= G420)
- binding magnesium ion: D459 (= D449), N486 (= N476), E488 (≠ F478)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E51), P81 (= P77), Q118 (= Q114), G432 (= G422), M434 (= M424), M464 (= M454)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
42% identity, 98% coverage: 4:565/573 of query aligns to 92:664/687 of P07342
- R241 (= R153) binding
- 355:376 (vs. 261:282, 59% identical) binding
- 407:426 (vs. 304:323, 30% identical) binding
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
42% identity, 98% coverage: 4:565/573 of query aligns to 12:584/607 of 6u9dB
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (≠ S29), I38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M274 (= M260), V301 (≠ T287), V417 (= V396), G443 (= G422), M445 (= M424), D470 (= D449), N497 (= N476), E499 (≠ F478), Q500 (≠ L479), M502 (= M481), V503 (= V482), W506 (= W485)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (= G28), V111 (= V103), P112 (= P104), F121 (= F113), K171 (= K163), D299 (= D285), R300 (= R286), M502 (= M481), W506 (= W485)
- binding flavin-adenine dinucleotide: R161 (= R153), A228 (≠ G215), G229 (= G216), N232 (≠ I219), T254 (= T240), L255 (= L241), Q256 (≠ M242), L272 (= L258), M274 (= M260), G294 (= G280), R296 (= R282), D298 (= D284), R300 (= R286), V301 (≠ T287), E327 (≠ D304), V328 (≠ I305), N332 (≠ S309), D346 (≠ S323), A347 (= A324), M422 (= M401), G440 (= G419), G441 (= G420)
- binding magnesium ion: D470 (= D449), N497 (= N476)
- binding thiamine diphosphate: E59 (= E51), P85 (= P77), V417 (= V396), G418 (= G397), Q419 (= Q398), H420 (= H399), G443 (= G422), M445 (= M424), A471 (≠ G450), S472 (= S451), N497 (= N476), E499 (≠ F478), Q500 (≠ L479), G501 (= G480), M502 (= M481), V503 (= V482)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
41% identity, 98% coverage: 6:565/573 of query aligns to 14:575/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (= H399), G426 (= G422), M428 (= M424), G452 (= G448), D453 (= D449), G454 (= G450), S455 (= S451), M458 (= M454), N480 (= N476), H482 (≠ F478), L483 (= L479), G484 (= G480), M485 (= M481), V486 (= V482)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G214), G223 (= G215), G224 (= G216), T246 (= T240), L247 (= L241), M248 (= M242), L264 (= L258), M266 (= M260), H267 (= H261), G286 (= G280), V287 (= V281), R288 (= R282), D290 (= D284), R292 (= R286), V293 (≠ T287), D310 (= D304), I311 (= I305), D329 (≠ S323), V330 (≠ A324), M405 (= M401), G423 (= G419)
- binding magnesium ion: F370 (≠ Y366), D453 (= D449), M458 (= M454), Q461 (= Q457), N480 (= N476), H482 (≠ F478), K533 (≠ P522)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M260), R292 (= R286), M485 (= M481), W489 (= W485), S568 (≠ R558)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
41% identity, 98% coverage: 6:565/573 of query aligns to 14:575/582 of 5wj1A
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (≠ S29), S38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M260), V293 (≠ T287), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ F478), L483 (= L479), M485 (= M481), V486 (= V482), W489 (= W485), H558 (≠ E548)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G214), G223 (= G215), G224 (= G216), T246 (= T240), L247 (= L241), M248 (= M242), M263 (= M257), L264 (= L258), G286 (= G280), R288 (= R282), V293 (≠ T287), D310 (= D304), I311 (= I305), D329 (≠ S323), V330 (≠ A324), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ F478)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M260), D291 (= D285), R292 (= R286), M485 (= M481), W489 (= W485), S568 (≠ R558)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (= H399), M428 (= M424), D453 (= D449), G454 (= G450), S455 (= S451), M458 (= M454), N480 (= N476), H482 (≠ F478), L483 (= L479), G484 (= G480), M485 (= M481), V486 (= V482)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
41% identity, 98% coverage: 6:565/573 of query aligns to 14:575/582 of 5k6tA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (≠ S29), S38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M260), V293 (≠ T287), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ F478), L483 (= L479), M485 (= M481), V486 (= V482), W489 (= W485), H558 (≠ E548)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H261), R292 (= R286), M485 (= M481), W489 (= W485), S568 (≠ R558)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G214), G223 (= G215), G224 (= G216), T246 (= T240), L247 (= L241), M248 (= M242), L264 (= L258), G286 (= G280), R288 (= R282), D290 (= D284), R292 (= R286), V293 (≠ T287), D310 (= D304), I311 (= I305), D329 (≠ S323), V330 (≠ A324), Q404 (= Q400), M405 (= M401), G423 (= G419)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ F478)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (= H399), G426 (= G422), M428 (= M424), G452 (= G448), G454 (= G450), S455 (= S451), N480 (= N476), H482 (≠ F478), L483 (= L479), G484 (= G480)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
41% identity, 98% coverage: 6:565/573 of query aligns to 14:575/582 of 5k6rA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (≠ S29), S38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M260), V293 (≠ T287), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ F478), L483 (= L479), M485 (= M481), V486 (= V482), W489 (= W485), H558 (≠ E548)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R286), W489 (= W485), S568 (≠ R558)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G214), G223 (= G215), G224 (= G216), T246 (= T240), L247 (= L241), M248 (= M242), L264 (= L258), M266 (= M260), G286 (= G280), R288 (= R282), R292 (= R286), V293 (≠ T287), D310 (= D304), I311 (= I305), G328 (= G322), D329 (≠ S323), V330 (≠ A324), M405 (= M401), G423 (= G419)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ F478)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (= H399), G426 (= G422), M428 (= M424), D453 (= D449), G454 (= G450), S455 (= S451), M458 (= M454), N480 (= N476), H482 (≠ F478), L483 (= L479), G484 (= G480), M485 (= M481), V486 (= V482)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
41% identity, 98% coverage: 6:565/573 of query aligns to 14:575/582 of 1z8nA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (≠ S29), S38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M260), V293 (≠ T287), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ F478), L483 (= L479), M485 (= M481), V486 (= V482), W489 (= W485), H558 (≠ E548)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K127), R161 (= R153), Y191 (≠ E179), R194 (= R183), D291 (= D285), R292 (= R286), D312 (= D306), W489 (= W485), G569 (= G559)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G214), G224 (= G216), T246 (= T240), L247 (= L241), M248 (= M242), L264 (= L258), G265 (= G259), M266 (= M260), H267 (= H261), G286 (= G280), V287 (= V281), R288 (= R282), D290 (= D284), R292 (= R286), V293 (≠ T287), D310 (= D304), I311 (= I305), D329 (≠ S323), V330 (≠ A324), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476)
- binding thiamine diphosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (= H399), G426 (= G422), M428 (= M424), G452 (= G448), G454 (= G450), S455 (= S451), N480 (= N476), H482 (≠ F478), L483 (= L479), G484 (= G480), M485 (= M481), V486 (= V482)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
41% identity, 98% coverage: 6:565/573 of query aligns to 14:575/582 of 1yi1A
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (≠ S29), S38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M260), V293 (≠ T287), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ F478), L483 (= L479), M485 (= M481), V486 (= V482), W489 (= W485), H558 (≠ E548)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D285), R292 (= R286), W489 (= W485), S568 (≠ R558)
- binding flavin-adenine dinucleotide: R161 (= R153), G223 (= G215), G224 (= G216), T246 (= T240), L247 (= L241), M248 (= M242), M263 (= M257), L264 (= L258), G265 (= G259), M266 (= M260), H267 (= H261), G286 (= G280), V287 (= V281), R288 (= R282), D290 (= D284), V293 (≠ T287), D310 (= D304), I311 (= I305), D329 (≠ S323), V330 (≠ A324), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ F478)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
41% identity, 98% coverage: 6:565/573 of query aligns to 14:575/582 of 1yi0A
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (≠ S29), S38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M260), V293 (≠ T287), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ F478), L483 (= L479), M485 (= M481), V486 (= V482), W489 (= W485), H558 (≠ E548)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D285), R292 (= R286), W489 (= W485), S568 (≠ R558)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G214), G223 (= G215), G224 (= G216), T246 (= T240), L247 (= L241), M248 (= M242), L264 (= L258), G265 (= G259), M266 (= M260), H267 (= H261), G286 (= G280), V287 (= V281), R288 (= R282), D290 (= D284), R292 (= R286), V293 (≠ T287), D310 (= D304), I311 (= I305), G328 (= G322), D329 (≠ S323), V330 (≠ A324), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ F478)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
41% identity, 98% coverage: 6:565/573 of query aligns to 14:575/582 of 1yhzA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (≠ S29), S38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M260), V293 (≠ T287), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ F478), L483 (= L479), M485 (= M481), V486 (= V482), W489 (= W485), H558 (≠ E548)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D285), R292 (= R286), M485 (= M481), W489 (= W485), S568 (≠ R558)
- binding flavin-adenine dinucleotide: R161 (= R153), G223 (= G215), G224 (= G216), T246 (= T240), L247 (= L241), M248 (= M242), L264 (= L258), M266 (= M260), H267 (= H261), G286 (= G280), V287 (= V281), R288 (= R282), D290 (= D284), V293 (≠ T287), D310 (= D304), I311 (= I305), D329 (≠ S323), V330 (≠ A324), Q404 (= Q400), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ F478)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
41% identity, 98% coverage: 6:565/573 of query aligns to 14:575/582 of 1yhyA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (≠ S29), S38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M260), V293 (≠ T287), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ F478), L483 (= L479), M485 (= M481), V486 (= V482), W489 (= W485), H558 (≠ E548)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D285), R292 (= R286), V486 (= V482), W489 (= W485), S568 (≠ R558)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G214), G223 (= G215), G224 (= G216), T246 (= T240), L247 (= L241), M248 (= M242), L264 (= L258), G265 (= G259), M266 (= M260), H267 (= H261), G286 (= G280), V287 (= V281), R288 (= R282), D290 (= D284), V293 (≠ T287), D310 (= D304), I311 (= I305), D329 (≠ S323), V330 (≠ A324), Q404 (= Q400), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ F478)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
41% identity, 98% coverage: 6:565/573 of query aligns to 14:575/582 of 1ybhA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (≠ S29), S38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M260), V293 (≠ T287), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ F478), L483 (= L479), M485 (= M481), V486 (= V482), W489 (= W485), H558 (≠ E548)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M260), D291 (= D285), R292 (= R286), M485 (= M481), W489 (= W485), S568 (≠ R558)
- binding flavin-adenine dinucleotide: R161 (= R153), G223 (= G215), G224 (= G216), T246 (= T240), L247 (= L241), M248 (= M242), L264 (= L258), M266 (= M260), H267 (= H261), G286 (= G280), V287 (= V281), R288 (= R282), D290 (= D284), V293 (≠ T287), D310 (= D304), I311 (= I305), D329 (≠ S323), V330 (≠ A324), Q404 (= Q400), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ F478)
Query Sequence
>5209298 FitnessBrowser__PV4:5209298
MEKLSGASMIVRSLIDEGVKHIFGYPGGSVLDIYDALHQKSGIEHILVRHEQAAVHMADG
YARATGKVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVPSNLIGNDAFQECDMIG
ISRPVVKHSFLVTDAKDIPAIIKKAFYIASTGRPGPVVVDIPKDCLNPQILHEYQYPDEI
NMRSYNPTTTGHKGQIRRGLQALLKAKKPVLYVGGGAVISGADQQILKLSDRLGLPVVST
LMGLGAFPGTHANSVGMLGMHGCYEANMAMHNADLIFGIGVRFDDRTTNNVEKYCPNATI
LHIDIDPSSISKTVRVDIPIVGSADSVLDDMLALLDDEPSMKNDEGAIDYWWSEINQWRS
RNSLAYDKSSERIKPQQVIETLHKLTNGDAYVASDVGQHQMFAALYYPFNKPRRWINSGG
LGTMGFGLPAAMGVKMAKPDETVICVTGDGSIQMNIQELSTALQYDTPVKIINLNNRFLG
MVKQWQDMIYSGRHSHSYMDSVPNFAKIAEAYGHVGMTISDPAELEAGLEKALAMKDKLV
FVDISVDETEHVYPMQIRGGGMNEMWLSKTEKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory