SitesBLAST
Comparing 5209311 FitnessBrowser__PV4:5209311 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
52% identity, 97% coverage: 2:385/395 of query aligns to 1:389/391 of 2gqnA
- active site: R54 (= R55), Y107 (= Y108), D181 (= D180), K206 (= K205)
- binding (5-hydroxy-6-methyl-4-((2-(2-(2-nitrobenzamido)acetyl)hydrazinyl)methyl)pyridin-3-yl)methyl dihydrogen phosphate: C81 (≠ S82), G82 (= G83), A83 (≠ S84), Y107 (= Y108), E108 (= E109), D181 (= D180), A203 (= A202), T205 (= T204), K206 (= K205), M215 (= M214), Y334 (≠ F332), S335 (= S333), W336 (= W334), R368 (= R364)
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
52% identity, 97% coverage: 2:385/395 of query aligns to 1:389/391 of 2fq6A
- active site: R54 (= R55), Y107 (= Y108), D181 (= D180), K206 (= K205)
- binding phosphoric acid mono-(5-hydroxy-6-methyl-4-{[2-(2-trifluoromethyl-benzoylamino)-acetyl]-hydrazonomethyl}-pyridin-3-ylmethyl)ester: C81 (≠ S82), G82 (= G83), A83 (≠ S84), Y107 (= Y108), P109 (= P110), D181 (= D180), A203 (= A202), T205 (= T204), K206 (= K205), M215 (= M214), Y334 (≠ F332), S335 (= S333), W336 (= W334), R368 (= R364)
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
52% identity, 97% coverage: 2:385/395 of query aligns to 1:389/391 of 1cl2A
- active site: R54 (= R55), Y107 (= Y108), D181 (= D180), K206 (= K205)
- binding (2E,3E)-4-(2-aminoethoxy)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: C81 (≠ S82), G82 (= G83), A83 (≠ S84), Y107 (= Y108), D181 (= D180), A203 (= A202), T205 (= T204), K206 (= K205), M215 (= M214), Y334 (≠ F332), S335 (= S333), W336 (= W334), R368 (= R364)
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
52% identity, 97% coverage: 2:385/395 of query aligns to 2:390/392 of 1cl1B
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
52% identity, 97% coverage: 2:385/395 of query aligns to 5:393/395 of P06721
- K210 (= K205) modified: N6-(pyridoxal phosphate)lysine
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
54% identity, 97% coverage: 4:385/395 of query aligns to 3:389/391 of 8u99A
- binding pyridoxal-5'-phosphate: C81 (≠ S82), G82 (= G83), A83 (≠ S84), Y107 (= Y108), D181 (= D180), T205 (= T204), K206 (= K205), M215 (= M214), W336 (= W334)
- binding serine: Y107 (= Y108), K206 (= K205), Y334 (≠ F332), S335 (= S333), W336 (= W334), R368 (= R364)
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
54% identity, 97% coverage: 4:385/395 of query aligns to 3:389/391 of 8u98A
- binding glycine: Y107 (= Y108), K206 (= K205), Y334 (≠ F332), S335 (= S333), W336 (= W334), R368 (= R364)
- binding pyridoxal-5'-phosphate: Y52 (= Y53), R54 (= R55), C81 (≠ S82), G82 (= G83), A83 (≠ S84), Y107 (= Y108), D181 (= D180), A203 (= A202), T205 (= T204), K206 (= K205), M215 (= M214), W336 (= W334)
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
54% identity, 97% coverage: 4:385/395 of query aligns to 3:389/391 of 8sa9A
- binding pyridoxal-5'-phosphate: C81 (≠ S82), G82 (= G83), A83 (≠ S84), Y107 (= Y108), D181 (= D180), A203 (= A202), T205 (= T204), K206 (= K205), M215 (= M214), W336 (= W334)
- binding [({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino](oxo)acetic acid: C81 (≠ S82), G82 (= G83), A83 (≠ S84), Y107 (= Y108), D181 (= D180), A203 (= A202), T205 (= T204), K206 (= K205), M215 (= M214), S335 (= S333), W336 (= W334), R368 (= R364)
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
54% identity, 97% coverage: 4:385/395 of query aligns to 4:390/392 of 8sabA
- binding lysine: N9 (≠ S9), R12 (= R12), R13 (≠ D13), K14 (= K14), T17 (≠ S17), L330 (≠ H327), E341 (= E338)
- binding pyridoxal-5'-phosphate: C82 (≠ S82), G83 (= G83), A84 (≠ S84), Y108 (= Y108), D182 (= D180), A204 (= A202), T206 (= T204), K207 (= K205), M216 (= M214), W337 (= W334)
- binding alanyl-pyridoxal-5'-phosphate: C82 (≠ S82), G83 (= G83), A84 (≠ S84), Y108 (= Y108), D182 (= D180), A204 (= A202), T206 (= T204), K207 (= K205), M216 (= M214), Y335 (≠ F332), S336 (= S333), W337 (= W334), R369 (= R364)
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
54% identity, 97% coverage: 4:385/395 of query aligns to 10:396/398 of 8sadA
- binding magnesium ion: A359 (≠ D348), R362 (= R351), A365 (≠ T354)
- binding pyridoxal-5'-phosphate: C88 (≠ S82), G89 (= G83), A90 (≠ S84), Y114 (= Y108), D188 (= D180), A210 (= A202), T212 (= T204), K213 (= K205), M222 (= M214), W343 (= W334)
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
52% identity, 97% coverage: 2:385/395 of query aligns to 1:389/391 of 4itxA
- active site: R54 (= R55), Y107 (= Y108), D181 (= D180), K206 (= K205)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: C81 (≠ S82), G82 (= G83), A83 (≠ S84), Y107 (= Y108), D181 (= D180), A203 (= A202), T205 (= T204), K206 (= K205), M215 (= M214), Y334 (≠ F332), S335 (= S333), W336 (= W334), R368 (= R364)
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
35% identity, 97% coverage: 1:385/395 of query aligns to 1:372/373 of 4l0oH
- active site: R40 (= R55), Y92 (= Y108), D164 (= D180), K189 (= K205)
- binding pyridoxal-5'-phosphate: Y38 (= Y53), R40 (= R55), S67 (= S82), G68 (= G83), L69 (≠ S84), Y92 (= Y108), D164 (= D180), S186 (≠ A202), T188 (= T204), K189 (= K205)
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
34% identity, 95% coverage: 5:380/395 of query aligns to 10:389/396 of 4omaA
- active site: R59 (= R55), Y112 (= Y108), D184 (= D180), K209 (= K205)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G87 (= G83), I88 (≠ S84), Y112 (= Y108), D184 (= D180), S206 (≠ A202), T208 (= T204), K209 (= K205), V337 (≠ F332), S338 (= S333), R373 (= R364)
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
34% identity, 95% coverage: 5:380/395 of query aligns to 10:389/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
34% identity, 95% coverage: 5:380/395 of query aligns to 10:389/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
34% identity, 95% coverage: 5:380/395 of query aligns to 10:389/396 of 3jw9A
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
34% identity, 95% coverage: 5:380/395 of query aligns to 9:388/395 of 5m3zA
- active site: R58 (= R55), Y111 (= Y108), D183 (= D180), K208 (= K205)
- binding norleucine: Y111 (= Y108), H113 (≠ P110), K208 (= K205), V336 (≠ F332), S337 (= S333)
- binding pyridoxal-5'-phosphate: G86 (= G83), I87 (≠ S84), Y111 (= Y108), E154 (= E151), D183 (= D180), T185 (= T182), S205 (≠ A202), T207 (= T204), K208 (= K205)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: G86 (= G83), I87 (≠ S84), Y111 (= Y108), D183 (= D180), S205 (≠ A202), T207 (= T204), K208 (= K205), V336 (≠ F332), S337 (= S333), R372 (= R364)
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
34% identity, 95% coverage: 5:380/395 of query aligns to 10:389/396 of 6egrA
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
34% identity, 95% coverage: 5:380/395 of query aligns to 10:389/396 of 4hf8A
- active site: R59 (= R55), Y112 (= Y108), D184 (= D180), K209 (= K205)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: G87 (= G83), I88 (≠ S84), Y112 (= Y108), E155 (= E151), N159 (≠ S155), D184 (= D180), S206 (≠ A202), K209 (= K205), S338 (= S333), R373 (= R364)
3mkjA Methionine gamma-lyase from citrobacter freundii with pyridoximine-5'- phosphate (see paper)
33% identity, 95% coverage: 5:380/395 of query aligns to 10:378/386 of 3mkjA
- active site: Y101 (= Y108), D173 (= D180), K198 (= K205)
- binding [5-hydroxy-4-(iminomethyl)-6-methyl-pyridin-3-yl]methyl dihydrogen phosphate: G76 (= G83), I77 (≠ S84), Y101 (= Y108), E144 (= E151), D173 (= D180), F176 (≠ W183), S195 (≠ A202), T197 (= T204), K198 (= K205)
Query Sequence
>5209311 FitnessBrowser__PV4:5209311
MKKETKIVSVGRDKKWSKGVINPPVFRASTVVFDTIEDMRHATKNRANGAMFYGRRGTPT
HFAFQAAIAELEGGVGTALYPSGSAAISGALLSFLKAGDHLLMVDTAYEPTRDLCDKLLK
GFGIETTYYDPLIGDGIEALIRPNTKVLFLESPGSITLEVQDVPTLSAIAHRHNLVVMLD
NTWASPINCRPFELGVDISIQAATKYIVGHSDVMLGTATANQAHWDQLRENSYLMGQCTS
ADDIYLASRGLRTLGVRMAQHEKNGLEVANLLATRPEVDHLRHPAFASCPGHEFFKRDFS
ASNGLFSFVLKRGNIKAITAFVEGMDHFKMGFSWGGYESLILGVFGIDKLRTATQWDSSK
PLIRLHVGLENPEDLIKDLEAGFARYNAVLDGQSD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory