Comparing 5209391 FitnessBrowser__PV4:5209391 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
70% identity, 96% coverage: 17:376/376 of query aligns to 17:376/377 of 7t1qA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
60% identity, 100% coverage: 1:375/376 of query aligns to 5:379/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
60% identity, 100% coverage: 1:375/376 of query aligns to 1:375/377 of P44514
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
62% identity, 98% coverage: 6:375/376 of query aligns to 6:375/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
62% identity, 98% coverage: 6:375/376 of query aligns to 6:375/376 of 4o23A
7lgpB Dape enzyme from shigella flexneri
61% identity, 100% coverage: 1:375/376 of query aligns to 3:376/377 of 7lgpB
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
74% identity, 47% coverage: 5:180/376 of query aligns to 5:180/265 of 4op4B
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
61% identity, 48% coverage: 1:180/376 of query aligns to 3:182/258 of 4h2kA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
24% identity, 99% coverage: 3:376/376 of query aligns to 8:383/383 of 7uoiA
7rsfA Acetylornithine deacetylase from escherichia coli
29% identity, 67% coverage: 6:258/376 of query aligns to 6:261/380 of 7rsfA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
31% identity, 40% coverage: 58:208/376 of query aligns to 95:235/426 of 3pfoA
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
23% identity, 82% coverage: 66:374/376 of query aligns to 79:398/408 of Q03154
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
28% identity, 36% coverage: 62:197/376 of query aligns to 86:222/458 of 2pokA
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
28% identity, 36% coverage: 62:198/376 of query aligns to 120:262/503 of Q8C165
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
39% identity, 20% coverage: 63:136/376 of query aligns to 97:170/471 of 3dljA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
39% identity, 20% coverage: 63:136/376 of query aligns to 128:201/507 of Q96KN2
Sites not aligning to the query:
3ki9A Crystal structure of staphylococcus aureus metallopeptidase (sapep/dape) in the mn2+ bound form (see paper)
39% identity, 22% coverage: 67:150/376 of query aligns to 85:165/467 of 3ki9A
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
23% identity, 79% coverage: 58:353/376 of query aligns to 90:449/475 of Q9D1A2
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
23% identity, 79% coverage: 58:353/376 of query aligns to 94:453/478 of 2zogA
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
23% identity, 79% coverage: 58:353/376 of query aligns to 94:453/478 of 2zofA
>5209391 FitnessBrowser__PV4:5209391
MSQDVLTLAQDLIARASVTPLDEGCQPLMAKRLAAKGFNIEPMVFEDTTNMWARRGDQGP
LFCFAGHTDVVPVGDLNRWHTPPFEPVVIDGYLHGRGAADMKGSLAAMVVATERFVDKHP
DHKGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLVGEPSSTHKLGDIVKNGRRG
SLTGNLTVKGVQGHVAYPHLADNPIHKAAPALDELARMKWDNGNEFFPPTSFQIANINGG
TGASNVIPGSLEVMFNFRYSTEVTAEILIQRVLNILDAHGLDYDISWIFNGLPFLTDAGP
LLDATREAIYEITGTETDPQTSGGTSDGRFIAPTGAQVIELGPVNATIHKVNECVKVEDI
EQLAKVYERILEKLLC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory