Comparing 5209443 FitnessBrowser__PV4:5209443 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cvqA Crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution (see paper)
71% identity, 100% coverage: 1:404/404 of query aligns to 1:404/404 of 4cvqA
P0A959 Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2 from Escherichia coli (strain K12) (see paper)
71% identity, 100% coverage: 1:404/404 of query aligns to 1:404/405 of P0A959
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
39% identity, 97% coverage: 7:399/404 of query aligns to 3:390/393 of 1xi9C
Q93703 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Caenorhabditis elegans (see 3 papers)
28% identity, 90% coverage: 34:398/404 of query aligns to 75:437/464 of Q93703
3tcmA Crystal structure of alanine aminotransferase from hordeum vulgare (see paper)
27% identity, 96% coverage: 15:402/404 of query aligns to 17:474/479 of 3tcmA
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
28% identity, 99% coverage: 3:401/404 of query aligns to 18:384/384 of 1o4sB
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
28% identity, 89% coverage: 35:392/404 of query aligns to 27:375/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
28% identity, 89% coverage: 35:392/404 of query aligns to 27:375/388 of 1gd9A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
27% identity, 94% coverage: 21:398/404 of query aligns to 21:394/402 of P14909
Sites not aligning to the query:
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
26% identity, 92% coverage: 21:392/404 of query aligns to 19:389/400 of 6f35A
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
26% identity, 92% coverage: 21:392/404 of query aligns to 29:399/410 of P58350
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
26% identity, 97% coverage: 7:399/404 of query aligns to 5:382/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
26% identity, 97% coverage: 7:399/404 of query aligns to 5:382/382 of 1gc3A
Q9LR30 Glutamate--glyoxylate aminotransferase 1; AtGGT2; Alanine aminotransferase GGT1; Alanine--glyoxylate aminotransferase GGT1; Alanine-2-oxoglutarate aminotransferase 1; EC 2.6.1.4; EC 2.6.1.2; EC 2.6.1.44; EC 2.6.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 96% coverage: 15:402/404 of query aligns to 20:472/481 of Q9LR30
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
28% identity, 94% coverage: 21:399/404 of query aligns to 19:382/382 of 1b5oA
3dydA Human tyrosine aminotransferase
27% identity, 86% coverage: 35:381/404 of query aligns to 17:364/388 of 3dydA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
28% identity, 94% coverage: 21:399/404 of query aligns to 19:382/385 of Q56232
Sites not aligning to the query:
P17735 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Homo sapiens (Human) (see paper)
27% identity, 86% coverage: 35:381/404 of query aligns to 73:420/454 of P17735
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
28% identity, 94% coverage: 21:399/404 of query aligns to 19:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
28% identity, 94% coverage: 21:399/404 of query aligns to 19:382/382 of 1bjwA
>5209443 FitnessBrowser__PV4:5209443
MRPIIKSNKLDTVCYDIRGPVHKEARRLEDEGHRILKLNIGNPAPFGFEAPEEIVRDVIL
NLPSAQGYSESKGLFSARKAIVQHYQSLGLFGVDIEDIYIGNGVSELIVMAMQGLLNSDD
EVLVPSPDYPLWTAAVHLSGGKAQHYRCDEESDWFPDLDDIKSKISSRTRGIVLINPNNP
TGAVYSRELLLEIIELCRQHDIILFADEIYDKILYDGAVHIPAATLSDDILTVTFNGLSK
SYRAAGFRVGWMMLSGNLKAAKSYIEGLDMLASMRLCSNVPNQHAIQTALGGYQSINELV
APEGRLTLQRNTCYELLNQIPGVSCKKPKGALYAFPKLDAKKFNLRDDERLVLDLLKEKK
ILLVQGTAFNWPEPDHLRVVFLPHKEDLHKALVEFGDFLTSYSQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory