Comparing 5209453 FitnessBrowser__PV4:5209453 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
1yw4A Crystal structure of the succinylglutamate desuccinylase from chromobacterium violaceum, northeast structural genomics target cvr22.
41% identity, 83% coverage: 58:350/355 of query aligns to 37:316/319 of 1yw4A
2bcoA X-ray structure of succinylglutamate desuccinalase from vibrio parahaemolyticus (rimd 2210633) at the resolution 2.3 a, northeast structural genomics target vpr14
35% identity, 97% coverage: 6:350/355 of query aligns to 2:327/338 of 2bcoA
>5209453 FitnessBrowser__PV4:5209453
MRDTLMLSKDFLQLTLDNPVGLEAFEFTLGQHTQVSVWDTGVIQFEPLVTYEANQESEQD
GKEEALKSIVLSSAVHGNETAPIELCDQLITALLSETLIARHRLLFLIGNPPAILNGTRF
VEENLNRLFSGAHAKGESNAERVRAKKLEQYVDRFFNAAPKDGSRYHYDLHTAIRASKHE
KFAIYPYPHGAPYSGEQIMFLAACGINTVLFHHEPTTTFSYFSAHGYQAHAFTIELGKVM
PMGQNDMTRFIAVKEMLTRLVSGRDLELGEFDPSQVNLYQVHRSINKQFDDFSFTFADDV
ENFTAFPRGYILAKDGGTEIKVEAESESIVFPNANVPVGQRTVLCLVPAKDYRVV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory