SitesBLAST
Comparing 5209622 FitnessBrowser__PV4:5209622 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1c0aA Crystal structure of the e. Coli aspartyl-tRNA synthetase : trnaasp : aspartyl-adenylate complex (see paper)
68% identity, 99% coverage: 1:586/592 of query aligns to 1:585/585 of 1c0aA
- active site: E482 (= E483), G485 (= G486), R537 (= R538)
- binding aspartyl-adenosine-5'-monophosphate: S193 (= S195), Q195 (= Q197), K198 (= K200), R217 (= R219), Q226 (= Q228), F229 (= F231), Q231 (= Q233), H448 (= H449), E482 (= E483), V483 (≠ L484), G484 (= G485), G485 (= G486), G486 (= G487), R489 (= R490), L531 (= L532), A532 (= A533), G534 (= G535), R537 (= R538)
- binding adenosine monophosphate: F304 (= F306), V306 (= V308), K347 (= K349), G348 (= G350), A350 (= A352)
- binding : R26 (= R26), R28 (= R28), D29 (= D29), L30 (= L30), G31 (= G31), S32 (≠ G32), L33 (≠ V33), F35 (= F35), Q46 (= Q46), F48 (≠ V48), D50 (= D50), P51 (= P51), R64 (= R64), R76 (= R76), R78 (= R78), N82 (≠ Q82), N84 (= N84), M87 (= M87), E93 (= E93), P109 (= P109), D111 (= D113), N113 (= N115), H114 (≠ Q116), N116 (= N118), T117 (= T119), E119 (= E121), T169 (= T171), P170 (= P172), E171 (= E173), G172 (= G174), A173 (= A175), S193 (= S195), R217 (= R219), E219 (= E221), D220 (= D222), R222 (= R224), A223 (= A225), R225 (= R227), I343 (= I345), H448 (= H449), H449 (= H450), F514 (= F515), R549 (= R550), T557 (= T558), T558 (= T559), A559 (≠ T560)
4wj3M Crystal structure of the asparagine transamidosome from pseudomonas aeruginosa (see paper)
65% identity, 99% coverage: 1:589/592 of query aligns to 1:588/589 of 4wj3M
- active site: R219 (= R219), E221 (= E221), R227 (= R227), Q228 (= Q228), E482 (= E483), G485 (= G486), R537 (= R538)
- binding : R28 (= R28), D29 (= D29), H30 (≠ L30), G32 (= G32), V33 (= V33), F35 (= F35), Q46 (= Q46), R64 (= R64), R76 (= R76), R78 (= R78), A82 (≠ Q82), N84 (= N84), E93 (= E93), T107 (≠ A107), D113 (= D113), V118 (≠ N118)
Q51422 Aspartate--tRNA(Asp/Asn) ligase; Aspartyl-tRNA synthetase; AspRS; Non-discriminating aspartyl-tRNA synthetase; ND-AspRS; EC 6.1.1.23 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
64% identity, 100% coverage: 1:591/592 of query aligns to 2:591/591 of Q51422
- H31 (≠ L30) mutation to L: Enhances enzyme specificity for tRNA(Asp) over tRNA(Asn) by 3.5-fold, by reducing enzyme's ability to misacylate tRNA(Asn) when tested against E.coli tRNA, but shows little effect when tested against P.aeruginosa tRNA.
- G82 (≠ S81) mutation to K: Enhances enzyme specificity for tRNA(Asp) over tRNA(Asn) by 4.2-fold, by reducing enzyme's ability to misacylate tRNA(Asn) when tested against E.coli tRNA, but shows little effect when tested against P.aeruginosa tRNA.
4wj4A Crystal structure of non-discriminating aspartyl-tRNA synthetase from pseudomonas aeruginosa complexed with tRNA(asn) and aspartic acid (see paper)
65% identity, 99% coverage: 1:586/592 of query aligns to 1:585/585 of 4wj4A
- active site: R219 (= R219), E221 (= E221), R227 (= R227), Q228 (= Q228), E482 (= E483), G485 (= G486), R537 (= R538)
- binding aspartic acid: S195 (= S195), Q197 (= Q197), H450 (= H450), R489 (= R490), L531 (= L532)
- binding : R26 (= R26), R28 (= R28), D29 (= D29), H30 (≠ L30), G31 (= G31), G32 (= G32), V33 (= V33), F35 (= F35), Q46 (= Q46), R64 (= R64), R76 (= R76), P79 (= P79), A82 (≠ Q82), N84 (= N84), E93 (= E93), T107 (≠ A107), P109 (= P109), D113 (= D113), E114 (≠ K114), D117 (≠ H117), E121 (= E121), A175 (= A175), E221 (= E221), D222 (= D222), R224 (= R224), A225 (= A225), R227 (= R227), Y346 (= Y346), A447 (= A447), H449 (= H449), H450 (= H450), R549 (= R550), T557 (= T558), Q558 (≠ T559), S559 (≠ T560)
P56459 Aspartate--tRNA(Asp/Asn) ligase; Aspartyl-tRNA synthetase; AspRS; Non-discriminating aspartyl-tRNA synthetase; ND-AspRS; EC 6.1.1.23 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
52% identity, 99% coverage: 1:584/592 of query aligns to 1:575/577 of P56459
- L81 (≠ Q82) mutation to N: Enhances enzyme specificity for tRNA(Asp) over tRNA(Asn), by reducing enzyme's ability to misacylate tRNA(Asn).
- L86 (≠ M87) mutation to M: Enhances enzyme specificity for tRNA(Asp) over tRNA(Asn), by reducing enzyme's ability to misacylate tRNA(Asn).
4rmfA Biochemical and structural characterization of mycobacterial aspartyl- tRNA synthetase asps, a promising tb drug target (see paper)
47% identity, 98% coverage: 1:581/592 of query aligns to 1:579/579 of 4rmfA
- active site: R215 (= R219), E217 (= E221), R223 (= R227), Q224 (= Q228), E481 (= E483), G484 (= G486), R536 (= R538)
- binding 2,2-bis(hydroxymethyl)propane-1,3-diol: H447 (= H449), D474 (= D476), E481 (= E483)
1g51B Aspartyl tRNA synthetase from thermus thermophilus at 2.4 a resolution (see paper)
49% identity, 99% coverage: 2:585/592 of query aligns to 3:578/580 of 1g51B
- active site: R223 (= R219), E225 (= E221), R231 (= R227), Q232 (= Q228), E476 (= E483), G479 (= G486), R531 (= R538)
- binding aspartyl-adenosine-5'-monophosphate: E177 (= E173), S199 (= S195), Q201 (= Q197), K204 (= K200), R223 (= R219), Q232 (= Q228), F235 (= F231), Q237 (= Q233), H442 (= H449), E476 (= E483), G478 (= G485), G479 (= G486), G480 (= G487), R483 (= R490), I525 (≠ L532), A526 (= A533), G528 (= G535), R531 (= R538)
- binding adenosine monophosphate: V313 (= V308), Q347 (≠ K349), G348 (= G350), L349 (= L351), A350 (= A352), V389 (≠ G397), A390 (= A398)
1g51A Aspartyl tRNA synthetase from thermus thermophilus at 2.4 a resolution (see paper)
49% identity, 99% coverage: 2:585/592 of query aligns to 3:578/580 of 1g51A
- active site: R223 (= R219), E225 (= E221), R231 (= R227), Q232 (= Q228), E476 (= E483), G479 (= G486), R531 (= R538)
- binding aspartyl-adenosine-5'-monophosphate: E177 (= E173), Q201 (= Q197), K204 (= K200), R223 (= R219), R231 (= R227), Q232 (= Q228), F235 (= F231), Q237 (= Q233), H442 (= H449), H443 (= H450), E476 (= E483), G478 (= G485), G479 (= G486), G480 (= G487), R483 (= R490), I525 (≠ L532), A526 (= A533), G528 (= G535), R531 (= R538)
1efwA Crystal structure of aspartyl-tRNA synthetase from thermus thermophilus complexed to trnaasp from escherichia coli (see paper)
49% identity, 99% coverage: 2:585/592 of query aligns to 3:578/580 of 1efwA
- active site: R223 (= R219), E225 (= E221), R231 (= R227), Q232 (= Q228), E476 (= E483), G479 (= G486), R531 (= R538)
- binding : R27 (= R26), R29 (= R28), D30 (= D29), L31 (= L30), G32 (= G31), G33 (= G32), L34 (≠ V33), F36 (= F35), Q47 (= Q46), H51 (≠ D50), P52 (= P51), R64 (= R64), R78 (= R78), E80 (≠ D80), N82 (= N84), R84 (≠ Q86), E91 (= E93), T105 (≠ A107), P107 (= P109), E125 (vs. gap), R343 (≠ I345)
6sjcB Structure of t. Thermophilus asprs in complex with 5'-o-(n-(l- aspartyl)-sulfamoyl)adenosine (see paper)
49% identity, 99% coverage: 2:585/592 of query aligns to 4:579/581 of 6sjcB
- binding 5'-O-(L-alpha-aspartylsulfamoyl)adenosine: E178 (= E173), Q202 (= Q197), K205 (= K200), R224 (= R219), R232 (= R227), Q233 (= Q228), F236 (= F231), Q238 (= Q233), E477 (= E483), V478 (≠ L484), G479 (= G485), G480 (= G486), G481 (= G487), R484 (= R490), I526 (≠ L532), A527 (= A533), G529 (= G535), R532 (= R538)
6hhxA Structure of t. Thermophilus asprs in complex with 5'-o-(n-(l- aspartyl)-sulfamoyl)cytidine (see paper)
50% identity, 99% coverage: 2:585/592 of query aligns to 4:574/574 of 6hhxA
- binding 5'-O-(N-(L-aspartyl)-sulfamoyl)cytidine: Q202 (= Q197), K205 (= K200), R224 (= R219), F236 (= F231), Q238 (= Q233), H438 (= H449), E472 (= E483), V473 (≠ L484), G474 (= G485), G475 (= G486), G476 (= G487), R479 (= R490), I521 (≠ L532), A522 (= A533), G524 (= G535)
6hhwA Structure of t. Thermophilus asprs in complex with 5'-o-(n-(l- aspartyl)-sulfamoyl)uridine (see paper)
50% identity, 99% coverage: 2:585/592 of query aligns to 4:574/574 of 6hhwA
- binding 5'-O-(N-(L-aspartyl)-sulfamoyl)uridine: Q202 (= Q197), K205 (= K200), R224 (= R219), F236 (= F231), Q238 (= Q233), H438 (= H449), E472 (= E483), V473 (≠ L484), G474 (= G485), G475 (= G486), G476 (= G487), R479 (= R490), I521 (≠ L532), A522 (= A533), G524 (= G535)
6hhvA Structure of t. Thermophilus asprs in complex with 5'-o-(n-(l- aspartyl)-sulfamoyl)n3-methyluridine (see paper)
50% identity, 99% coverage: 2:585/592 of query aligns to 4:574/574 of 6hhvA
- binding 5'-O-(N-(L-aspartyl)-sulfamoyl)N3-methyluridine: Q202 (= Q197), R224 (= R219), F236 (= F231), Q238 (= Q233), H438 (= H449), E472 (= E483), V473 (≠ L484), G474 (= G485), G475 (= G486), G476 (= G487), R479 (= R490), I521 (≠ L532), A522 (= A533), G524 (= G535), R527 (= R538)
4o2dA Crystal structure of aspartyl-tRNA synthetase from mycobacterium smegmatis with bound aspartic acid (see paper)
46% identity, 98% coverage: 1:582/592 of query aligns to 2:579/580 of 4o2dA
- active site: R216 (= R219), E218 (= E221), R222 (= R227), Q223 (= Q228), E480 (= E483), G483 (= G486), R535 (= R538)
- binding aspartic acid: E170 (= E173), S192 (= S195), Q194 (= Q197), Q228 (= Q233), H446 (= H449), H447 (= H450), G483 (= G486), R487 (= R490), I529 (≠ L532), A530 (= A533)
5w25A Crystal structure of aspartyl-tRNA synthetase from mycobacterium tuberculosis complexed with l-aspartic acid
46% identity, 98% coverage: 1:579/592 of query aligns to 3:582/583 of 5w25A
- active site: R220 (= R219), E222 (= E221), R228 (= R227), Q229 (= Q228), E486 (= E483), G489 (= G486), R541 (= R538)
- binding aspartic acid: E174 (= E173), Q198 (= Q197), R220 (= R219), H452 (= H449), H453 (= H450), G489 (= G486), R493 (= R490)
- binding lysine: D159 (≠ G158), R211 (= R210)
7ap4A Thermus thermophilus aspartyl-tRNA synthetase in complex with compound asps7hmdda (see paper)
49% identity, 99% coverage: 2:585/592 of query aligns to 4:573/573 of 7ap4A
- binding (3~{S})-3-azanyl-4-[[(2~{R},3~{S},4~{R},5~{R})-5-[7-azanyl-5-(hydroxymethyl)benzimidazol-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxysulfonylamino]-4-oxidanylidene-butanoic acid: Q200 (= Q197), R222 (= R219), R230 (= R227), Q231 (= Q228), F234 (= F231), Q236 (= Q233), E471 (= E483), G473 (= G485), G474 (= G486), G475 (= G487), R478 (= R490), I520 (≠ L532), A521 (= A533), G523 (= G535)
Q6PI48 Aspartate--tRNA ligase, mitochondrial; Aspartyl-tRNA synthetase; AspRS; EC 6.1.1.12 from Homo sapiens (Human) (see 2 papers)
38% identity, 99% coverage: 1:584/592 of query aligns to 49:633/645 of Q6PI48
- R58 (≠ N10) mutation to G: No effect on its mitochondria localization.
- T136 (= T89) mutation to S: No effect on its mitochondria localization.
- Q184 (≠ A137) to K: in LBSL; Significant impairment of its mitochondrial matrix localization; dbSNP:rs1469160736
- R263 (≠ K216) to Q: in LBSL; no effect on its mitochondrial localization; dbSNP:rs121918207
- G338 (≠ P291) mutation to E: No effect on its mitochondria localization.
- L613 (≠ P564) to F: in LBSL; no effect on its mitochondrial localization; dbSNP:rs121918212
- L626 (= L577) to Q: in LBSL; no effect on its mitochondrial localization; dbSNP:rs121918213
Sites not aligning to the query:
- 45 S → G: in LBSL; no effect on its mitochondrial localization; dbSNP:rs121918209
4o2dB Crystal structure of aspartyl-tRNA synthetase from mycobacterium smegmatis with bound aspartic acid (see paper)
50% identity, 51% coverage: 1:299/592 of query aligns to 2:294/515 of 4o2dB
Sites not aligning to the query:
3nemB Aspartyl-tRNA synthetase complexed with aspartyl adenylate (see paper)
35% identity, 47% coverage: 2:282/592 of query aligns to 3:293/438 of 3nemB
Sites not aligning to the query:
3nemA Aspartyl-tRNA synthetase complexed with aspartyl adenylate (see paper)
35% identity, 47% coverage: 2:282/592 of query aligns to 3:293/438 of 3nemA
Sites not aligning to the query:
- active site: 361, 364, 412
- binding aspartyl-adenosine-5'-monophosphate: 339, 361, 362, 363, 364, 365, 368, 406, 407, 409, 412
Query Sequence
>5209622 FitnessBrowser__PV4:5209622
MRSHYCGDVNRSHVGEEVTLVGWVNRSRDLGGVVFLDLRDREGVIQVVYDPDLPEVFDVA
STLRSEFCVQVKGLVRARPDSQINDQMRTGEIEVLGKALTILNSAPALPINMDKNQHNTE
EQRLKYRYLDLRRPEMAERIIFRSKVTSAVRRFLDGNGFLDIETPILTKATPEGARDYLV
PSRTYKGQFFALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDIETSF
MTSAQVMDKTEEMVRGLFKELLNVDLGEFPKMTFAEAMRRYGSDKPDLRNPLELVDVADL
VKDVDFKVFQEPANDSEGRVAVLCVPGGASLSRKQLDEYGKYVNIYGAKGLAWMKVNELE
NGLEGIQSPVLKFLSEEVVKGILERTGAANGDLILFGADKANIVAEAMGALRLKVGEDFD
LLQGDWKPLWVVDFPMFERTSDGGLHAMHHPFTAPSGITPAELEADPTAAISDAYDMVLN
GCELGGGSVRIYDAEMQSAVFRILGINDEEAQEKFGFLLEALKYGTPPHAGLAFGLDRMV
MLMTGASSIRDVMAFPKTTTAACPLTNAPGFANPVQLEELGVSVVEAKKEQE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory