Comparing 5209664 FitnessBrowser__PV4:5209664 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
2yjvC Crystal structure of e. Coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb (see paper)
44% identity, 94% coverage: 6:159/164 of query aligns to 5:158/158 of 2yjvC
1nxjA Structure of rv3853 from mycobacterium tuberculosis (see paper)
42% identity, 90% coverage: 7:153/164 of query aligns to 9:155/156 of 1nxjA
3k4iA Crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. Tomato str. Dc3000
30% identity, 64% coverage: 54:158/164 of query aligns to 64:169/202 of 3k4iA
>5209664 FitnessBrowser__PV4:5209664
MQDLLPDLFDHYETQLSLLAPHYRQFGQKRIFWGEVVTVKCFEDNSKVKQLLGQLGEGRV
LVVDGGGSNRRALLGDMIAQSAVDNGWSGIVINGYVRDVGALAQMPIGIQALGANPIKTD
KRDLGDVNVTLEIDRVIIKPGMMLYADDNGVAVSSEQLDLSQLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory