Comparing 5209701 FitnessBrowser__PV4:5209701 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q93099 Homogentisate 1,2-dioxygenase; Homogentisate oxygenase; Homogentisic acid oxidase; Homogentisicase; EC 1.13.11.5 from Homo sapiens (Human) (see 13 papers)
24% identity, 74% coverage: 97:383/386 of query aligns to 128:427/445 of Q93099
Sites not aligning to the query:
3zdsF Structure of homogentisate 1,2-dioxygenase in complex with reaction intermediates of homogentisate with oxygen. (see paper)
23% identity, 74% coverage: 100:383/386 of query aligns to 122:414/426 of 3zdsF
3zdsC Structure of homogentisate 1,2-dioxygenase in complex with reaction intermediates of homogentisate with oxygen. (see paper)
23% identity, 74% coverage: 100:383/386 of query aligns to 122:414/426 of 3zdsC
Q88E47 Homogentisate 1,2-dioxygenase; HGDO; Homogentisate oxygenase; Homogentisic acid oxidase; Homogentisicase; EC 1.13.11.5 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
23% identity, 74% coverage: 100:383/386 of query aligns to 129:421/433 of Q88E47
3zdsA Structure of homogentisate 1,2-dioxygenase in complex with reaction intermediates of homogentisate with oxygen. (see paper)
23% identity, 74% coverage: 100:383/386 of query aligns to 121:413/425 of 3zdsA
4aq6D Substrate bound homogentisate 1,2-dioxygenase (see paper)
23% identity, 74% coverage: 100:383/386 of query aligns to 123:415/427 of 4aq6D
1ey2A Human homogentisate dioxygenase with fe(ii) (see paper)
25% identity, 63% coverage: 97:338/386 of query aligns to 127:364/419 of 1ey2A
Q9Y041 Homogentisate 1,2-dioxygenase; Homogentisate oxygenase; Homogentisic acid oxidase; Homogentisicase; EC 1.13.11.5 from Caenorhabditis elegans (see paper)
26% identity, 58% coverage: 117:338/386 of query aligns to 152:374/437 of Q9Y041
>5209701 FitnessBrowser__PV4:5209701
MPFYVRQGEIPHKRHITFKKENGELYREELFSTHGFSNIYSNKYHHNMPTKALEVSPFEV
NHGQTWQDTLIQNYKLDAKLADREGNFYSARNKIFFNNDVAMYSAKVTEATEEFYRNAYA
DEVIFVHEGQGKLYSEYGVLDVKKWDYLVIPRGTTYQLKFDDYSQVRLFVIEAFSMVEVP
KHFRNEYGQLLESAPYCERDIRVPSLQEAVVEKGAFPLVCKFGDKYQLTQLEWHPFDLVG
WDGCVYPWAFNIQDYAPKVGQIHLPPSDHLVFTAHNFVICNFVPRPYDFHPQSIPAPYYH
NNIDSDEVLYYVDGDFMSRTGIEAGYMTLHQKGVPHGPQPGRTEASVGKKETYEYAVMVD
TFAPLQLTQHVQGCMSKDYNRSWLED
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory