Comparing 5209799 FitnessBrowser__PV4:5209799 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
P00900 Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 from Serratia marcescens (see 3 papers)
55% identity, 93% coverage: 3:189/202 of query aligns to 4:189/193 of P00900
Sites not aligning to the query:
1i7qB Anthranilate synthase from s. Marcescens (see paper)
55% identity, 93% coverage: 3:189/202 of query aligns to 3:188/192 of 1i7qB
P00903 Aminodeoxychorismate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85 from Escherichia coli (strain K12) (see paper)
48% identity, 92% coverage: 3:187/202 of query aligns to 2:185/187 of P00903
Q42565 Anthranilate synthase beta subunit 1, chloroplastic; Anthranilate synthase component 2-1; Anthranilate synthase, glutamine amidotransferase component 2-1; Protein TRYPTOPHAN BIOSYNTHESIS 4; Protein WEAK ETHYLENE INSENSITIVE 7; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
41% identity, 90% coverage: 3:183/202 of query aligns to 75:260/276 of Q42565
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
38% identity, 91% coverage: 1:183/202 of query aligns to 4:184/673 of 8hx8A
Sites not aligning to the query:
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
38% identity, 68% coverage: 51:187/202 of query aligns to 45:181/475 of 2ywcA
Sites not aligning to the query:
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
30% identity, 91% coverage: 1:183/202 of query aligns to 3:141/632 of 8hx9A
Sites not aligning to the query:
5tw7F Crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
35% identity, 67% coverage: 51:185/202 of query aligns to 49:186/490 of 5tw7F
Sites not aligning to the query:
7yc6A Crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase
27% identity, 91% coverage: 3:185/202 of query aligns to 2:173/183 of 7yc6A
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
29% identity, 76% coverage: 44:197/202 of query aligns to 64:225/693 of P49915
Sites not aligning to the query:
1gpmA Escherichia coli gmp synthetase complexed with amp and pyrophosphate (see paper)
25% identity, 95% coverage: 2:192/202 of query aligns to 7:201/501 of 1gpmA
Sites not aligning to the query:
2vxoB Human gmp synthetase in complex with xmp (see paper)
29% identity, 76% coverage: 44:197/202 of query aligns to 42:200/658 of 2vxoB
Sites not aligning to the query:
Q9LVW7 Carbamoyl phosphate synthase small chain, chloroplastic; Carbamoyl phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 79% coverage: 15:173/202 of query aligns to 254:405/430 of Q9LVW7
Sites not aligning to the query:
Q18990 Multifunctional protein pyr-1; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Caenorhabditis elegans (see 3 papers)
26% identity, 75% coverage: 21:172/202 of query aligns to 199:341/2198 of Q18990
Sites not aligning to the query:
P05990 Multifunctional protein r; Protein rudimentary; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Drosophila melanogaster (Fruit fly) (see 2 papers)
27% identity, 64% coverage: 44:172/202 of query aligns to 227:355/2224 of P05990
Sites not aligning to the query:
>5209799 FitnessBrowser__PV4:5209799
MKLYLLDNFDSFTYNLVDQFRSLGFEVVIYRNDLDAQFIADKLLQEQGKAALVLSPGPGA
PHEAGCLMALIGLLAGKVPMLGICLGHQAMIEHFGGKVERAKQVVHGKASPTIHNCQGIF
AGLPSPLPVARYHSLVATQVPDCLEVIATTEEMPMAISHKSVKAVGFQFHPESILTTLGS
QLLTQTLTYLTQDAQLSSGQGV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory