SitesBLAST
Comparing 5209802 FitnessBrowser__PV4:5209802 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5kzmB Crystal structure of tryptophan synthase alpha-beta chain complex from francisella tularensis (see paper)
83% identity, 97% coverage: 2:393/403 of query aligns to 1:393/395 of 5kzmB
P0A879 Tryptophan synthase beta chain; EC 4.2.1.20 from Escherichia coli (strain K12) (see 2 papers)
80% identity, 98% coverage: 1:393/403 of query aligns to 1:394/397 of P0A879
- M1 (= M1) modified: Initiator methionine, Removed
- C62 (≠ T62) active site, Nucleophile
8b05B Tryptophan synthase - cryo-trapping by the spitrobot crystal plunger after 20 sec (see paper)
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/394 of 8b05B
- binding indole: A213 (= A214), Q214 (= Q215)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H85 (= H86), K86 (= K87), T109 (= T110), G110 (= G111), Q113 (= Q114), H114 (= H115), T189 (= T190), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), D304 (= D305), E349 (= E350), S376 (= S376)
2j9xB Tryptophan synthase in complex with gp, alpha-d,l-glycerol- phosphate, cs, ph6.5 - alpha aminoacrylate form - (gp)e(a- a) (see paper)
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/394 of 2j9xB
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H85 (= H86), K86 (= K87), T109 (= T110), G110 (= G111), A111 (= A112), Q113 (= Q114), H114 (= H115), T189 (= T190), G231 (= G232), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), E349 (= E350), S376 (= S376), G377 (= G377)
3pr2B Tryptophan synthase indoline quinonoid structure with f9 inhibitor in alpha site (see paper)
80% identity, 97% coverage: 3:391/403 of query aligns to 1:390/391 of 3pr2B
- active site: K85 (= K87), E107 (= E109), S375 (= S376)
- binding (Z)-N-[(1E)-1-carboxy-2-(2,3-dihydro-1H-indol-1-yl)ethylidene]{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methanaminium: H84 (= H86), K85 (= K87), E107 (= E109), T108 (= T110), G109 (= G111), A110 (= A112), G111 (= G113), Q112 (= Q114), H113 (= H115), L164 (= L166), T188 (= T190), G230 (= G232), G231 (= G233), G232 (= G234), S233 (= S235), N234 (= N236), G301 (= G303), F304 (= F306), E348 (= E350), S375 (= S376)
6xt0B Salmonella typhimurium tryptophan synthase complexed with dioxindolyl- l-alanine and d-glycerol-3-phosphate (see paper)
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/396 of 6xt0B
- active site: K86 (= K87), E108 (= E109), S376 (= S376)
- binding sodium ion: G231 (= G232), P269 (= P270), F305 (= F306), S307 (= S308)
- binding 4-[(E)-({1-carboxy-2-[(3R)-3-hydroxy-2-oxo-2,3-dihydro-1H-indol-3-yl]ethan-1-id-1-yl}iminio)methyl]-2-methyl-5-[(phosphonooxy)methyl]pyridin-1-ium-3-olate: H85 (= H86), K86 (= K87), E108 (= E109), T109 (= T110), G110 (= G111), Q113 (= Q114), H114 (= H115), L165 (= L166), G188 (= G189), T189 (= T190), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), F305 (= F306), E349 (= E350), S376 (= S376)
- binding 4-[(E)-({1-carboxy-2-[(3R)-3-hydroxy-2-oxo-2,3-dihydro-1H-indol-3-yl]ethan-1-id-1-yl}iminio)methyl]-2-methyl-5-[(phosphonooxy)methyl]pyridin-1-ium-3-olate: H85 (= H86), K86 (= K87), E108 (= E109), T109 (= T110), G110 (= G111), Q113 (= Q114), H114 (= H115), L165 (= L166), T189 (= T190), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), F305 (= F306), E349 (= E350), S376 (= S376), G377 (= G377)
6xrhB Salmonella typhimurium tryptophan synthase complexed with oxindolyl-l- alanine and d-glycerol-3-phosphate (see paper)
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/396 of 6xrhB
- active site: K86 (= K87), E108 (= E109), S376 (= S376)
- binding sodium ion: G231 (= G232), P269 (= P270), F305 (= F306), S307 (= S308)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-3-[(3S)-2-oxo-2,3-dihydro-1H-indol-3-yl]-L-alanine: H85 (= H86), K86 (= K87), T109 (= T110), G110 (= G111), A111 (= A112), Q113 (= Q114), H114 (= H115), L165 (= L166), G188 (= G189), T189 (= T190), V230 (= V231), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), F305 (= F306), E349 (= E350), S376 (= S376)
- binding 4-[(E)-({1-carboxy-2-[(3S)-2-oxo-2,3-dihydro-1H-indol-3-yl]ethan-1-id-1-yl}iminio)methyl]-2-methyl-5-[(phosphonooxy)methyl]pyridin-1-ium-3-olate: H85 (= H86), K86 (= K87), E108 (= E109), T109 (= T110), G110 (= G111), Q113 (= Q114), H114 (= H115), L165 (= L166), T189 (= T190), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), F305 (= F306), E349 (= E350), S376 (= S376)
6xoyB Salmonella typhimurium tryptophan synthase complexed with d-tryptophan and d-glycerol-3-phosphate (see paper)
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/396 of 6xoyB
- active site: K86 (= K87), E108 (= E109), S376 (= S376)
- binding sodium ion: G231 (= G232), P269 (= P270), F305 (= F306), S307 (= S308)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-D-tryptophan: H85 (= H86), K86 (= K87), E108 (= E109), T109 (= T110), G110 (= G111), A111 (= A112), Q113 (= Q114), H114 (= H115), L165 (= L166), T189 (= T190), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), F305 (= F306), E349 (= E350), S376 (= S376)
6xinB The crystal structure of tryptophan synthase from salmonella enterica serovar typhimurium in complex with (2s)-3-amino-3-imino-2- phenyldiazenylpropanamide at the enzyme alpha-site.
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/396 of 6xinB
- active site: K86 (= K87), E108 (= E109), S376 (= S376)
- binding pyridoxal-5'-phosphate: H85 (= H86), K86 (= K87), T189 (= T190), G231 (= G232), G233 (= G234), S234 (= S235), N235 (= N236), E349 (= E350), S376 (= S376), G377 (= G377)
- binding (2R,3Z)-3-amino-3-imino-2-[(E)-phenyldiazenyl]propanamide: V16 (= V17), P17 (= P18), L20 (= L21), L173 (≠ M174), Y185 (= Y186), L187 (= L188), P193 (= P194), F279 (= F280)
4kkxB Crystal structure of tryptophan synthase from salmonella typhimurium with 2-aminophenol quinonoid in the beta site and the f6 inhibitor in the alpha site (see paper)
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/395 of 4kkxB
- active site: K86 (= K87), E108 (= E109), S376 (= S376)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-3-[(2-hydroxyphenyl)amino]-D-alanine: H85 (= H86), K86 (= K87), E108 (= E109), T109 (= T110), G110 (= G111), A111 (= A112), Q113 (= Q114), H114 (= H115), L165 (= L166), T189 (= T190), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), F305 (= F306), E349 (= E350), S376 (= S376), G377 (= G377)
4hpxB Crystal structure of tryptophan synthase at 1.65 a resolution in complex with alpha aminoacrylate e(a-a) and benzimidazole in the beta site and the f9 inhibitor in the alpha site (see paper)
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/395 of 4hpxB
- active site: K86 (= K87), E108 (= E109), S376 (= S376)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H85 (= H86), K86 (= K87), T109 (= T110), G110 (= G111), A111 (= A112), G112 (= G113), Q113 (= Q114), H114 (= H115), T189 (= T190), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), E349 (= E350), S376 (= S376), G377 (= G377)
- binding benzimidazole: T2 (= T3), L4 (= L5), N5 (≠ D6), K86 (= K87), E108 (= E109), A135 (= A136), K136 (= K137), L165 (= L166), G188 (= G189), T189 (= T190), G231 (= G232), G232 (= G233), F305 (= F306)
4hpjB Crystal structure of tryptophan synthase at 1.45 a resolution in complex with 2-aminophenol quinonoid in the beta site and the f9 inhibitor in the alpha site (see paper)
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/395 of 4hpjB
- active site: K86 (= K87), E108 (= E109), S376 (= S376)
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]-3-[(2-hydroxyphenyl)amino]propanoic acid: H85 (= H86), K86 (= K87), E108 (= E109), T109 (= T110), G110 (= G111), A111 (= A112), Q113 (= Q114), H114 (= H115), L165 (= L166), T189 (= T190), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), E349 (= E350), S376 (= S376), G377 (= G377)
4hn4B Tryptophan synthase in complex with alpha aminoacrylate e(a-a) form and the f9 inhibitor in the alpha site (see paper)
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/395 of 4hn4B
- active site: K86 (= K87), E108 (= E109), S376 (= S376)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H85 (= H86), K86 (= K87), T109 (= T110), G110 (= G111), A111 (= A112), Q113 (= Q114), H114 (= H115), T189 (= T190), G231 (= G232), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), E349 (= E350), S376 (= S376), G377 (= G377)
7lv5B The internal aldimine form of the wild-type salmonella typhimurium tryptophan synthase in complex with inhibitor n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9f) at the enzyme alpha-site, cesium ion at the metal coordination site and l-histidine at the enzyme beta-site at 1.55 angstrom resolution
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/393 of 7lv5B
- binding histidine: K86 (= K87), E108 (= E109), T109 (= T110), G110 (= G111), Q113 (= Q114), H114 (= H115), L165 (= L166)
- binding pyridoxal-5'-phosphate: H85 (= H86), K86 (= K87), T189 (= T190), G231 (= G232), G233 (= G234), S234 (= S235), N235 (= N236), E349 (= E350), S376 (= S376), G377 (= G377)
3cepB Structure of a tryptophan synthase quinonoid intermediate (see paper)
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/393 of 3cepB
- binding indoline: K86 (= K87), L165 (= L166), T189 (= T190), G232 (= G233), F305 (= F306)
- binding 3-hydroxy-2-iminopropanoic acid: K86 (= K87), T109 (= T110), G110 (= G111), A111 (= A112), G112 (= G113), Q113 (= Q114), H114 (= H115)
- binding pyridoxal-5'-phosphate: H85 (= H86), K86 (= K87), T189 (= T190), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), E349 (= E350), S376 (= S376), G377 (= G377)
5cgqB Crystal structure of tryptophan synthase from salmonella typhimurium in complex with f9 ligand in the alpha-site and the product l- tryptophan in the beta-site.
80% identity, 96% coverage: 3:390/403 of query aligns to 2:390/390 of 5cgqB
- active site: K86 (= K87), E108 (= E109), S376 (= S376)
- binding pyridoxal-5'-phosphate: H85 (= H86), K86 (= K87), T189 (= T190), G231 (= G232), G233 (= G234), S234 (= S235), N235 (= N236), E349 (= E350), S376 (= S376), G377 (= G377)
- binding tryptophan: K86 (= K87), E108 (= E109), T109 (= T110), G110 (= G111), A111 (= A112), Q113 (= Q114), H114 (= H115), L165 (= L166), T189 (= T190), F305 (= F306)
2clfB Tryptophan synthase in complex with n-(4'- trifluoromethoxybenzoyl)-2-amino-1-ethylphosphate (f6) - highf6 complex (see paper)
80% identity, 97% coverage: 3:393/403 of query aligns to 2:393/394 of 2clfB
- active site: K86 (= K87), E108 (= E109), S376 (= S376)
- binding 2-{[4-(trifluoromethoxy)benzoyl]amino}ethyl dihydrogen phosphate: P17 (= P18), E108 (= E109), T109 (= T110), G110 (= G111), H114 (= H115), L165 (= L166), C169 (= C170), L187 (= L188), G188 (= G189), T189 (= T190), F279 (= F280)
- binding pyridoxal-5'-phosphate: H85 (= H86), K86 (= K87), T189 (= T190), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), E349 (= E350), S376 (= S376), G377 (= G377)
Sites not aligning to the query:
1qopB Crystal structure of wild-type tryptophan synthase complexed with indole propanol phosphate (see paper)
80% identity, 96% coverage: 3:390/403 of query aligns to 2:390/390 of 1qopB
- binding sodium ion: G231 (= G232), P269 (= P270), F305 (= F306), S307 (= S308)
- binding pyridoxal-5'-phosphate: A84 (= A85), H85 (= H86), K86 (= K87), T189 (= T190), G231 (= G232), G233 (= G234), S234 (= S235), N235 (= N236), E349 (= E350), S376 (= S376), G377 (= G377)
1a50B Crystal structure of wild-type tryptophan synthase complexed with 5- fluoroindole propanol phosphate (see paper)
80% identity, 96% coverage: 3:390/403 of query aligns to 2:390/390 of 1a50B
- active site: K86 (= K87), E108 (= E109), T109 (= T110), T189 (= T190), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), S350 (= S351), S376 (= S376)
- binding pyridoxal-5'-phosphate: H85 (= H86), K86 (= K87), T189 (= T190), G231 (= G232), G232 (= G233), G233 (= G234), S234 (= S235), N235 (= N236), E349 (= E350), S376 (= S376), G377 (= G377)
7jqwB The external aldimine crystal structure of salmonella typhimurium tryptophan synthase mutant beta-s377a in complex with cesium ion at the metal coordination site. The single beta-q114 rotamer conformation allows a hydrogen bond to form with the plp oxygen at the position 3 in the ring
79% identity, 97% coverage: 3:393/403 of query aligns to 2:393/395 of 7jqwB
- binding 2-aminophenol: Q18 (= Q19), M21 (= M22), P22 (= P23), H81 (= H82), V116 (= V117)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: H85 (= H86), K86 (= K87), T109 (= T110), G110 (= G111), A111 (= A112), Q113 (= Q114), H114 (= H115), T189 (= T190), G231 (= G232), G233 (= G234), S234 (= S235), N235 (= N236), G302 (= G303), D304 (= D305), E349 (= E350)
- binding serine: K128 (= K129), R149 (= R150), G152 (= G153), A153 (= A154), E154 (= E155)
Query Sequence
>5209802 FitnessBrowser__PV4:5209802
MMTKLDPYFGEYGGMFVPQILMPALKQLEAAFVDAQNDPSFQAEFTDLLKNYAGRPTALT
LTRNLSPNPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATA
LACALLGLKCKVYMGAKDVERQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSAS
YDKAHYLLGTAAGPHPFPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFIDEPSVKLIGVEPAGLGIDTPKHGAPLKHGKTGIFFGMKAPLMQDKEGQIEESYSI
SAGLDFPSVGPQHAHLAATGRATYESATDDEALAAFQLLARSEGIIPALESAHALAYAIK
LAEAATEETLLVVNLSGRGDKDIFTVADILEKQQANNEESGNE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory