SitesBLAST
Comparing 5209832 FitnessBrowser__PV4:5209832 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
56% identity, 95% coverage: 16:350/351 of query aligns to 1:336/338 of 1udaA
- active site: S124 (= S139), A125 (= A140), T126 (= T141), Y149 (= Y163), K153 (= K167), M189 (≠ I203)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), Y11 (= Y26), I12 (= I27), D31 (= D46), N32 (= N47), L33 (= L48), C34 (≠ S49), N35 (≠ R50), S36 (≠ A51), D58 (= D73), I59 (= I74), F80 (= F95), A81 (= A96), G82 (= G97), K84 (= K99), S122 (= S137), Y149 (= Y163), K153 (= K167), Y177 (= Y191), P180 (= P194)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (= T141), N179 (= N193), N199 (= N213), L200 (= L214), A216 (≠ S230), I217 (≠ V231), F218 (= F232), R231 (= R245), Y233 (= Y247), R292 (= R306), D295 (= D309), Y299 (≠ S313)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
56% identity, 95% coverage: 16:350/351 of query aligns to 1:336/338 of 1naiA
- active site: S124 (= S139), A125 (= A140), T126 (= T141), Y149 (= Y163), K153 (= K167), M189 (≠ I203)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), Y11 (= Y26), I12 (= I27), D31 (= D46), N32 (= N47), L33 (= L48), C34 (≠ S49), N35 (≠ R50), S36 (≠ A51), D58 (= D73), I59 (= I74), F80 (= F95), A81 (= A96), G82 (= G97), K84 (= K99), Y149 (= Y163), K153 (= K167), Y177 (= Y191), P180 (= P194)
- binding 1,3-propandiol: N35 (≠ R50), K84 (= K99), E191 (= E205), P193 (= P207)
- binding uridine-5'-diphosphate: N179 (= N193), N199 (= N213), L200 (= L214), L215 (= L229), A216 (≠ S230), R231 (= R245), Y233 (= Y247), R292 (= R306)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
56% identity, 95% coverage: 16:350/351 of query aligns to 1:336/338 of 1lrjA
- active site: S124 (= S139), A125 (= A140), T126 (= T141), Y149 (= Y163), K153 (= K167), M189 (≠ I203)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), Y11 (= Y26), I12 (= I27), D31 (= D46), N32 (= N47), L33 (= L48), C34 (≠ S49), N35 (≠ R50), S36 (≠ A51), D58 (= D73), I59 (= I74), F80 (= F95), A81 (= A96), G82 (= G97), K84 (= K99), Y149 (= Y163), K153 (= K167), Y177 (= Y191), P180 (= P194)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V101), S124 (= S139), F178 (= F192), N179 (= N193), L200 (= L214), L215 (= L229), A216 (≠ S230), F218 (= F232), R231 (= R245), Y233 (= Y247), V269 (= V283), R292 (= R306), D295 (= D309)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
56% identity, 95% coverage: 16:350/351 of query aligns to 1:336/338 of 2udpA
- active site: S124 (= S139), A125 (= A140), T126 (= T141), Y149 (= Y163), K153 (= K167), M189 (≠ I203)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), Y11 (= Y26), I12 (= I27), D31 (= D46), N32 (= N47), L33 (= L48), C34 (≠ S49), N35 (≠ R50), S36 (≠ A51), D58 (= D73), I59 (= I74), F80 (= F95), A81 (= A96), G82 (= G97), K84 (= K99), S122 (= S137), S124 (= S139), Y149 (= Y163), K153 (= K167), Y177 (= Y191)
- binding phenyl-uridine-5'-diphosphate: N179 (= N193), N199 (= N213), L200 (= L214), A216 (≠ S230), I217 (≠ V231), F218 (= F232), R231 (= R245), Y233 (= Y247), V269 (= V283), R292 (= R306), D295 (= D309)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
56% identity, 95% coverage: 16:350/351 of query aligns to 1:336/338 of 1udcA
- active site: S124 (= S139), A125 (= A140), T126 (= T141), Y149 (= Y163), K153 (= K167), M189 (≠ I203)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), Y11 (= Y26), I12 (= I27), D31 (= D46), N32 (= N47), C34 (≠ S49), N35 (≠ R50), S36 (≠ A51), D58 (= D73), I59 (= I74), F80 (= F95), A81 (= A96), G82 (= G97), K84 (= K99), S122 (= S137), Y149 (= Y163), K153 (= K167), Y177 (= Y191), P180 (= P194)
- binding uridine-5'-diphosphate-mannose: T126 (= T141), Y149 (= Y163), N179 (= N193), N199 (= N213), L200 (= L214), L215 (= L229), A216 (≠ S230), I217 (≠ V231), F218 (= F232), R231 (= R245), Y233 (= Y247), V269 (= V283), R292 (= R306)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
56% identity, 95% coverage: 16:350/351 of query aligns to 1:336/338 of P09147
- YI 11:12 (= YI 26:27) binding
- DNLCNS 31:36 (≠ DNLSRA 46:51) binding
- DI 58:59 (= DI 73:74) binding
- FAGLK 80:84 (= FAGLK 95:99) binding
- N99 (= N114) binding
- S124 (= S139) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y163) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K167) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F192) binding
- Y299 (≠ S313) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
56% identity, 95% coverage: 16:350/351 of query aligns to 1:336/338 of 1kvrA
- active site: A124 (≠ S139), A125 (= A140), T126 (= T141), Y149 (= Y163), K153 (= K167), M189 (≠ I203)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), Y11 (= Y26), I12 (= I27), D31 (= D46), N32 (= N47), C34 (≠ S49), N35 (≠ R50), S36 (≠ A51), D58 (= D73), I59 (= I74), F80 (= F95), A81 (= A96), G82 (= G97), K84 (= K99), S122 (= S137), S123 (= S138), Y149 (= Y163), K153 (= K167), Y177 (= Y191), P180 (= P194)
- binding uridine-5'-diphosphate: N179 (= N193), N198 (= N212), N199 (= N213), L200 (= L214), A216 (≠ S230), I217 (≠ V231), F218 (= F232), R231 (= R245), Y233 (= Y247), V269 (= V283), R292 (= R306), D295 (= D309)
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
55% identity, 95% coverage: 16:350/351 of query aligns to 1:336/338 of 1a9yA
- active site: A124 (≠ S139), A125 (= A140), T126 (= T141), F149 (≠ Y163), K153 (= K167)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), Y11 (= Y26), I12 (= I27), D31 (= D46), N32 (= N47), C34 (≠ S49), N35 (≠ R50), S36 (≠ A51), D58 (= D73), I59 (= I74), F80 (= F95), A81 (= A96), G82 (= G97), K84 (= K99), S122 (= S137), S123 (= S138), F149 (≠ Y163), K153 (= K167), Y177 (= Y191), P180 (= P194)
- binding uridine-5'-diphosphate-glucose: A125 (= A140), T126 (= T141), N179 (= N193), N199 (= N213), L200 (= L214), A216 (≠ S230), I217 (≠ V231), F218 (= F232), R231 (= R245), Y233 (= Y247), R292 (= R306), D295 (= D309), Y299 (≠ S313)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
55% identity, 95% coverage: 17:351/351 of query aligns to 3:343/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), Y12 (= Y26), I13 (= I27), D32 (= D46), N33 (= N47), N36 (≠ R50), D62 (= D73), L63 (≠ I74), F84 (= F95), A85 (= A96), G86 (= G97), K88 (= K99), N103 (= N114), S126 (= S137), S128 (= S139), Y152 (= Y163), K156 (= K167), Y180 (= Y191), P183 (= P194)
- binding uridine-5'-diphosphate-glucose: S128 (= S139), A129 (= A140), F181 (= F192), N182 (= N193), N202 (= N213), L203 (= L214), T219 (≠ S230), V220 (= V231), Y221 (≠ F232), R234 (= R245), Y236 (= Y247), V275 (= V283), R298 (= R306), D301 (= D309)
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
55% identity, 95% coverage: 17:351/351 of query aligns to 3:343/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), Y12 (= Y26), I13 (= I27), D32 (= D46), N33 (= N47), N36 (≠ R50), D62 (= D73), L63 (≠ I74), F84 (= F95), A85 (= A96), G86 (= G97), K88 (= K99), N103 (= N114), S126 (= S137), S128 (= S139), Y152 (= Y163), K156 (= K167), Y180 (= Y191), P183 (= P194)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N193), N202 (= N213), L203 (= L214), T219 (≠ S230), Y221 (≠ F232), R234 (= R245), Y236 (= Y247), V275 (= V283), R298 (= R306), D301 (= D309)
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
55% identity, 95% coverage: 17:350/351 of query aligns to 3:343/345 of 1hzjA
- active site: S131 (= S139), A132 (= A140), T133 (= T141), Y156 (= Y163), K160 (= K167)
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), Y12 (= Y26), I13 (= I27), D32 (= D46), N33 (= N47), H35 (≠ S49), N36 (≠ R50), D65 (= D73), I66 (= I74), F87 (= F95), A88 (= A96), G89 (= G97), K91 (= K99), S129 (= S137), S131 (= S139), Y156 (= Y163), K160 (= K167), Y184 (= Y191), P187 (= P194)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N193), N206 (= N213), L207 (= L214), N223 (≠ S230), V224 (= V231), F225 (= F232), R238 (= R245), Y240 (= Y247), V276 (= V283), R299 (= R306), D302 (= D309)
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
55% identity, 95% coverage: 17:350/351 of query aligns to 3:343/347 of 1i3lA
- active site: S131 (= S139), A132 (= A140), T133 (= T141), Y156 (= Y163), K160 (= K167)
- binding galactose-uridine-5'-diphosphate: N186 (= N193), N206 (= N213), L207 (= L214), N223 (≠ S230), V224 (= V231), F225 (= F232), R238 (= R245), Y240 (= Y247), V276 (= V283), R299 (= R306), D302 (= D309)
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), Y12 (= Y26), I13 (= I27), D32 (= D46), N33 (= N47), H35 (≠ S49), N36 (≠ R50), D65 (= D73), I66 (= I74), F87 (= F95), A88 (= A96), G89 (= G97), K91 (= K99), S129 (= S137), S130 (= S138), S131 (= S139), Y156 (= Y163), K160 (= K167), Y184 (= Y191), P187 (= P194)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
55% identity, 95% coverage: 17:350/351 of query aligns to 3:343/347 of 1i3kA
- active site: S131 (= S139), A132 (= A140), T133 (= T141), Y156 (= Y163), K160 (= K167)
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), Y12 (= Y26), I13 (= I27), D32 (= D46), N33 (= N47), H35 (≠ S49), N36 (≠ R50), D65 (= D73), I66 (= I74), F87 (= F95), A88 (= A96), G89 (= G97), K91 (= K99), S129 (= S137), S131 (= S139), Y156 (= Y163), K160 (= K167), Y184 (= Y191), P187 (= P194)
- binding uridine-5'-diphosphate-glucose: F185 (= F192), N186 (= N193), N206 (= N213), L207 (= L214), N223 (≠ S230), V224 (= V231), F225 (= F232), R238 (= R245), Y240 (= Y247), V276 (= V283), R299 (= R306), D302 (= D309)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
55% identity, 95% coverage: 17:350/351 of query aligns to 4:344/348 of Q14376
- GYI 12:14 (= GYI 25:27) binding
- DNFHN 33:37 (≠ DNLSR 46:50) binding
- N34 (= N47) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (= DI 73:74) binding
- F88 (= F95) binding
- G90 (= G97) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (= K99) binding
- V94 (= V101) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ E110) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (= S139) mutation to A: Loss of activity.
- SAT 132:134 (= SAT 139:141) binding
- Y157 (= Y163) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K167) binding
- A180 (≠ V186) to V: in dbSNP:rs3204468
- L183 (= L189) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y191) binding
- YFN 185:187 (= YFN 191:193) binding
- NNL 206:208 (= NNL 212:214) binding
- NVF 224:226 (≠ SVF 230:232) binding
- R239 (= R245) binding
- K257 (≠ R263) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RPGD 306:309) binding
- C307 (≠ S313) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ K319) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (≠ D325) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (= R341) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
55% identity, 95% coverage: 17:350/351 of query aligns to 4:344/346 of 1ek6A
- active site: S132 (= S139), A133 (= A140), T134 (= T141), Y157 (= Y163), K161 (= K167)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G22), G12 (= G25), Y13 (= Y26), I14 (= I27), D33 (= D46), N34 (= N47), H36 (≠ S49), N37 (≠ R50), D66 (= D73), I67 (= I74), F88 (= F95), A89 (= A96), G90 (= G97), K92 (= K99), S130 (= S137), S131 (= S138), S132 (= S139), Y157 (= Y163), K161 (= K167), Y185 (= Y191), P188 (= P194)
- binding uridine-5'-diphosphate-glucose: S132 (= S139), Y157 (= Y163), F186 (= F192), N187 (= N193), N207 (= N213), L208 (= L214), N224 (≠ S230), V225 (= V231), F226 (= F232), R239 (= R245), Y241 (= Y247), V277 (= V283), R300 (= R306), D303 (= D309)
3enkA 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
57% identity, 96% coverage: 15:350/351 of query aligns to 4:339/340 of 3enkA
- active site: S127 (= S138), S128 (= S139), T130 (= T141), Y152 (= Y163), K156 (= K167)
- binding nicotinamide-adenine-dinucleotide: G11 (= G22), G14 (= G25), Y15 (= Y26), I16 (= I27), D35 (= D46), N36 (= N47), V38 (≠ S49), N39 (≠ R50), S40 (≠ A51), D62 (= D73), V63 (≠ I74), F84 (= F95), A85 (= A96), A86 (≠ G97), K88 (= K99), N103 (= N114), S126 (= S137), S128 (= S139), Y152 (= Y163), K156 (= K167), Y180 (= Y191), P183 (= P194)
- binding uridine-5'-diphosphate-glucose: T130 (= T141), N182 (= N193), N201 (= N212), N202 (= N213), L203 (= L214), R219 (≠ S230), V220 (= V231), F221 (= F232), R234 (= R245), Y236 (= Y247), V272 (= V283), R295 (= R306), D298 (= D309)
7kn1A Crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound NAD and formylated udp- arabinopyranose
53% identity, 93% coverage: 16:343/351 of query aligns to 3:330/336 of 7kn1A
- active site: S126 (= S139), Y150 (= Y163), K154 (= K167)
- binding nicotinamide-adenine-dinucleotide: G9 (= G22), G12 (= G25), Y13 (= Y26), I14 (= I27), D33 (= D46), S34 (≠ N47), C36 (≠ S49), N37 (≠ R50), D60 (= D73), I61 (= I74), F82 (= F95), A83 (= A96), A84 (≠ G97), K86 (= K99), S124 (= S137), S125 (= S138), S126 (= S139), Y150 (= Y163), K154 (= K167), Y178 (= Y191), P181 (= P194)
- binding UDP-4-deoxy-4-formamido-beta-L-arabinopyranose: V88 (= V101), S126 (= S139), Y150 (= Y163), N180 (= N193), S199 (≠ N212), N200 (= N213), L201 (= L214), Q217 (≠ S230), V218 (= V231), F219 (= F232), R232 (= R245), Y234 (= Y247), V270 (= V283), R293 (= R306), D296 (= D309)
Q564Q1 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Caenorhabditis elegans (see paper)
49% identity, 96% coverage: 16:351/351 of query aligns to 1:348/349 of Q564Q1
- P314 (= P317) mutation to L: In pv18; at the restrictive temperature of 25 degrees Celsius, embryos have cell-cell adhesion defects and die before hatching. The few surviving animals are arrested at the L1 larval stage. At the permissive temperature of 16-20 degrees Celsius, causes a developmental delay. Distal tip cell migration is impaired due to a reduced localization of metalloprotease mig-17 to the gonad basement membrane. Vulva lumen is smaller at the L4 larval stage. Accumulation of UDP-galactose (Gal) and reduction in UDP-N-acetylgalactosamine (GalNAc) levels. Hypersensitivity to a galactose-rich diet characterized by a slow development often resulting in an arrest at the L1 larval stage. Up-regulation of ER stress response protein hsp-4; expression is suppressed in an xbp-1 RNAi-mediated knockdown animals. Reduced survival upon E.faecalis or S.aureus-mediated infection.
6k0iA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glc (see paper)
50% identity, 95% coverage: 17:350/351 of query aligns to 2:335/335 of 6k0iA
- active site: S124 (= S139), A125 (= A140), T126 (= T141), Y149 (= Y163), K153 (= K167)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), F11 (≠ Y26), I12 (= I27), D31 (= D46), N32 (= N47), N35 (≠ R50), S36 (≠ A51), D58 (= D73), V59 (≠ I74), F80 (= F95), A81 (= A96), G82 (= G97), K84 (= K99), N99 (= N114), S122 (= S137), S123 (= S138), Y149 (= Y163), K153 (= K167), Y177 (= Y191), P180 (= P194)
- binding uridine-5'-diphosphate-glucose: K84 (= K99), S124 (= S139), Y149 (= Y163), F178 (= F192), N179 (= N193), A198 (≠ N212), N199 (= N213), L200 (= L214), Q216 (≠ S230), V217 (= V231), Y218 (≠ F232), R231 (= R245), Y233 (= Y247), V268 (= V283), R291 (= R306), D294 (= D309)
6k0hA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glcnac (see paper)
50% identity, 95% coverage: 17:350/351 of query aligns to 2:335/335 of 6k0hA
- active site: S124 (= S139), A125 (= A140), T126 (= T141), Y149 (= Y163), K153 (= K167)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), F11 (≠ Y26), I12 (= I27), D31 (= D46), N32 (= N47), G34 (≠ S49), N35 (≠ R50), S36 (≠ A51), D58 (= D73), V59 (≠ I74), F80 (= F95), A81 (= A96), G82 (= G97), K84 (= K99), N99 (= N114), S123 (= S138), Y149 (= Y163), K153 (= K167), Y177 (= Y191), P180 (= P194)
- binding uridine-diphosphate-n-acetylglucosamine: K84 (= K99), S124 (= S139), Y149 (= Y163), F178 (= F192), N179 (= N193), A198 (≠ N212), N199 (= N213), L200 (= L214), Q216 (≠ S230), V217 (= V231), Y218 (≠ F232), R231 (= R245), Y233 (= Y247), V268 (= V283), R291 (= R306), D294 (= D309)
Query Sequence
>5209832 FitnessBrowser__PV4:5209832
MSPGGKEVPEMKGEKMSILVTGGAGYIGSHACVELLSAGHQLVVLDNLSRAKFESLARVE
QITAAKLTFVEGDIRDERTLDALFSHYHIDAVMHFAGLKAVGESTRLPLEYYDNNVVGSM
RLLSAMTRHGVKTLVFSSSATVYGANPPLPIMEAAPRSSTNPYGQTKLVVEQMCAEWANA
KQDVSVILLRYFNPVGAHESGLIGEDPKGEPNNLLPYITQVAMGHRPYLSVFGSDYATTD
GTGVRDYIHVMDLVQGHLAALTRLHGVAGCHTFNLGSGQGYSVLEMVRAFEQASGKDIAL
HMAPRRPGDIAASYACPDKAARELDWRVARDLSQMMQDSWRWQCRNPRGYS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory