Comparing 5209916 FitnessBrowser__PV4:5209916 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1eyyA Crystal structure of the NADP+ dependent aldehyde dehydrogenase from vibrio harveyi. (see paper)
46% identity, 94% coverage: 24:512/521 of query aligns to 3:488/504 of 1eyyA
5u0mA Fatty aldehyde dehydrogenase from marinobacter aquaeolei vt8 and cofactor complex (see paper)
27% identity, 87% coverage: 9:461/521 of query aligns to 2:437/488 of 5u0mA
Sites not aligning to the query:
5u0lA X-ray crystal structure of fatty aldehyde dehydrogenase enzymes from marinobacter aquaeolei vt8 complexed with a substrate (see paper)
27% identity, 87% coverage: 9:461/521 of query aligns to 2:437/488 of 5u0lA
Sites not aligning to the query:
5gtlA NADPH complex structure of aldehyde dehydrogenase from bacillus cereus
25% identity, 76% coverage: 12:406/521 of query aligns to 18:403/491 of 5gtlA
Sites not aligning to the query:
5gtkA NAD+ complex structure of aldehyde dehydrogenase from bacillus cereus
25% identity, 76% coverage: 12:406/521 of query aligns to 18:403/491 of 5gtkA
Sites not aligning to the query:
3ty7B Crystal structure of aldehyde dehydrogenase family protein from staphylococcus aureus
24% identity, 82% coverage: 12:438/521 of query aligns to 7:421/454 of 3ty7B
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
25% identity, 83% coverage: 1:433/521 of query aligns to 1:422/482 of P25526
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
25% identity, 83% coverage: 3:433/521 of query aligns to 2:421/481 of 3jz4A
Sites not aligning to the query:
4jz6A Crystal structure of a salicylaldehyde dehydrogenase from pseudomonas putida g7 complexed with salicylaldehyde (see paper)
25% identity, 81% coverage: 14:437/521 of query aligns to 7:420/484 of 4jz6A
Sites not aligning to the query:
P17202 Aminoaldehyde dehydrogenase BADH; 4-trimethylammoniobutyraldehyde dehydrogenase BADH; Aminobutyraldehyde dehydrogenase BADH; Betaine aldehyde dehydrogenase; SoBADH; EC 1.2.1.-; EC 1.2.1.47; EC 1.2.1.19; EC 1.2.1.8 from Spinacia oleracea (Spinach) (see 3 papers)
23% identity, 81% coverage: 12:433/521 of query aligns to 9:426/497 of P17202
Sites not aligning to the query:
5ek6A Thermostable aldehyde dehydrogenase from pyrobaculum sp. 1860 complexed with NADP and isobutyraldehyde (see paper)
25% identity, 81% coverage: 13:432/521 of query aligns to 3:409/482 of 5ek6A
Sites not aligning to the query:
4h73A Thermostable aldehyde dehydrogenase from pyrobaculum sp. Complexed with NADP+
25% identity, 81% coverage: 13:432/521 of query aligns to 3:409/482 of 4h73A
Sites not aligning to the query:
5ekcE Thermostable aldehyde dehydrogenase from pyrobaculum sp.1860 complexed with NADP+
27% identity, 61% coverage: 7:324/521 of query aligns to 4:307/490 of 5ekcE
Sites not aligning to the query:
3rhdA Crystal structure of glyceraldehyde-3-phosphate dehydrogenase gapn from methanocaldococcus jannaschii dsm 2661 complexed with NADP
26% identity, 52% coverage: 45:314/521 of query aligns to 24:275/456 of 3rhdA
Sites not aligning to the query:
4v37A Crystal structure of betaine aldehyde dehydrogenase from spinach showing a thiohemiacetal with 3-aminopropionaldehyde
23% identity, 81% coverage: 12:433/521 of query aligns to 7:424/495 of 4v37A
Sites not aligning to the query:
5ur2B Crystal structure of proline utilization a (puta) from bdellovibrio bacteriovorus inactivated by n-propargylglycine (see paper)
25% identity, 86% coverage: 15:464/521 of query aligns to 477:914/959 of 5ur2B
Sites not aligning to the query:
4u3wA X-ray crystal structure of 2-aminomuconate 6-semialdehyde dehydrogenase from burkholderia cenocepacia
29% identity, 50% coverage: 12:274/521 of query aligns to 5:257/485 of 4u3wA
Sites not aligning to the query:
2d4eC Crystal structure of the hpcc from thermus thermophilus hb8
27% identity, 57% coverage: 13:308/521 of query aligns to 29:307/515 of 2d4eC
Sites not aligning to the query:
2eiwA Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound l-proline
26% identity, 87% coverage: 11:461/521 of query aligns to 35:477/516 of 2eiwA
Sites not aligning to the query:
4o6rA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
26% identity, 74% coverage: 52:438/521 of query aligns to 46:424/489 of 4o6rA
Sites not aligning to the query:
>5209916 FitnessBrowser__PV4:5209916
MTLSITNRLTGQHYINGEWQGEADAFQSFNPVANTQIDWHFASASDEQLAQATKAAEQAF
NSYRNKSDSERAAFLSSIAEHIEADKETIIEAAHLETGLPLARLQGETGRTCGQLRLFAQ
NLVNPIEQLIADMAQPERQPLPKPDTRLGKVALGPVAVFGASNFPLAFSTAGGDTASALA
AGCPVIVKGHPAHPATSELVTQAIEKAIKACDMPAGVFSLLQGHTPDLSTGLVEAPEIKA
VGFTGSLKVGRILADRCAARPEPIPFYGELGSTNPQFLLPGILAEQAETLAETQVQSMMM
GHGQFCTSPGLIVAVKGEALTRYCDRLSQTLAEQAASAMLTPGIAATYQQQTEALLAHPQ
LTLLSQGKAAEASHHTRPAAVKVDAAGYLADSALQQEVFGPFAIVVECQDAAQMQAVAEQ
IEGQLTATLHGNESDWAHAHSLVDAIGQRVGRLIFNQMPTGVEVCHSMNHGGPYPASTDS
RSTSVGSMAIHRWTRPICYQNMPTALLPEALRDGQSLLKRF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory