Comparing 5209954 FitnessBrowser__PV4:5209954 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
43% identity, 88% coverage: 7:223/246 of query aligns to 4:221/226 of 5xu1B
7mdyC Lolcde nucleotide-bound
48% identity, 85% coverage: 19:227/246 of query aligns to 13:225/226 of 7mdyC
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
48% identity, 85% coverage: 19:227/246 of query aligns to 16:228/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
48% identity, 83% coverage: 19:223/246 of query aligns to 13:221/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
47% identity, 85% coverage: 19:227/246 of query aligns to 15:227/229 of 7v8iD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
49% identity, 80% coverage: 25:222/246 of query aligns to 18:216/223 of 2pclA
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
42% identity, 88% coverage: 7:222/246 of query aligns to 2:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
41% identity, 88% coverage: 7:222/246 of query aligns to 2:223/230 of 1l2tA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
40% identity, 88% coverage: 7:222/246 of query aligns to 5:221/648 of P75831
8g4cB Bceabs atpgs high res tm (see paper)
38% identity, 80% coverage: 25:222/246 of query aligns to 22:221/248 of 8g4cB
Sites not aligning to the query:
7tchB Bceab e169q variant atp-bound conformation (see paper)
38% identity, 80% coverage: 25:222/246 of query aligns to 21:220/245 of 7tchB
Sites not aligning to the query:
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
41% identity, 94% coverage: 7:237/246 of query aligns to 5:233/650 of 5ws4A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
39% identity, 91% coverage: 7:229/246 of query aligns to 4:224/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
39% identity, 91% coverage: 7:229/246 of query aligns to 4:224/592 of 5lj7A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
41% identity, 89% coverage: 7:224/246 of query aligns to 2:216/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
40% identity, 89% coverage: 7:224/246 of query aligns to 3:216/241 of 4u00A
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
42% identity, 77% coverage: 26:215/246 of query aligns to 20:209/225 of 8iddA
Sites not aligning to the query:
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 86% coverage: 23:234/246 of query aligns to 20:245/330 of P9WQK5
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
42% identity, 77% coverage: 26:215/246 of query aligns to 20:209/227 of 8igqA
Sites not aligning to the query:
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
42% identity, 77% coverage: 26:215/246 of query aligns to 19:208/229 of A5U7B7
>5209954 FitnessBrowser__PV4:5209954
MLENSAIKVSDLYKSVTTQEGELTILNGINLDVKSGESVAILGPSGSGKSTLLGLLAALD
SPTKGEIVLDGVTLNGLDEEGKAALRKQKVSFIFQSFMLVDTLNALENVMLPAELSGISN
AKQKAQQMLERVGLSHRLNHFPNQLSGGEQQRVAIARAFICEPKVLFADEPTGNLDGANS
DRVADMLFELNRESDTTLVLVTHDLQLANRCQRRLNMQAGQLSEVMSETDNSGEQEMARS
SAAEAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory