Comparing 5210054 FitnessBrowser__PV4:5210054 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
55% identity, 97% coverage: 1:327/337 of query aligns to 1:328/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
30% identity, 92% coverage: 18:328/337 of query aligns to 19:324/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
30% identity, 91% coverage: 18:322/337 of query aligns to 18:307/310 of 4fwiB
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
34% identity, 79% coverage: 2:266/337 of query aligns to 2:252/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
35% identity, 77% coverage: 2:261/337 of query aligns to 2:247/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
34% identity, 77% coverage: 2:261/337 of query aligns to 2:247/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 82% coverage: 3:278/337 of query aligns to 1:261/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
27% identity, 82% coverage: 3:278/337 of query aligns to 2:262/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
27% identity, 82% coverage: 3:278/337 of query aligns to 2:262/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
27% identity, 82% coverage: 3:278/337 of query aligns to 2:262/344 of 3tuiC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
31% identity, 64% coverage: 23:236/337 of query aligns to 22:220/222 of 7arlD
7mdyC Lolcde nucleotide-bound
31% identity, 64% coverage: 23:236/337 of query aligns to 22:220/226 of 7mdyC
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 64% coverage: 23:236/337 of query aligns to 25:223/233 of P75957
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
31% identity, 64% coverage: 23:236/337 of query aligns to 24:222/229 of 7v8iD
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
29% identity, 65% coverage: 18:236/337 of query aligns to 13:215/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
29% identity, 65% coverage: 18:236/337 of query aligns to 13:215/219 of 8w6iD
Sites not aligning to the query:
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
29% identity, 65% coverage: 18:236/337 of query aligns to 13:215/218 of 8hd0A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 74% coverage: 12:261/337 of query aligns to 8:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 74% coverage: 12:261/337 of query aligns to 8:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 74% coverage: 12:261/337 of query aligns to 8:241/242 of 2olkA
>5210054 FitnessBrowser__PV4:5210054
MPLLDIRNLTIELDTPHGRVKALERVSLTLNPGEVHGLVGESGSGRTLLAKAILGIPGHN
WTIQADRMMWDGQNLMDMSPSERRVLMGSEMAMIFQDPISSLDPAIAVGTQIIEAMPENK
ELPWWKRGSDKRKKAQQWLHKVGIKETQKIMSSYAWELSDGECQKVMIAIAVANQPRLLI
ADEPTNSMEVRTQAQIFRLLSKLNQLQNVSILLISHELETLSQWCDRLTVMYSGQVMESG
VTSDVIANPYHPYTKALLDNIPDYSNPEHHKTMMQTLPGSAPALQHLPIGCRLGPRCPQA
QKLCVNQPSLCHQKDRYFACHFPYHNEPCHEEPLTKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory