Comparing 5210215 FitnessBrowser__PV4:5210215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
43% identity, 96% coverage: 3:221/227 of query aligns to 2:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
43% identity, 96% coverage: 3:221/227 of query aligns to 2:223/230 of 1l2tA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
42% identity, 99% coverage: 3:227/227 of query aligns to 4:226/226 of 5xu1B
8g4cB Bceabs atpgs high res tm (see paper)
43% identity, 88% coverage: 23:221/227 of query aligns to 23:221/248 of 8g4cB
Sites not aligning to the query:
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
43% identity, 97% coverage: 6:225/227 of query aligns to 2:225/650 of 5ws4A
7tchB Bceab e169q variant atp-bound conformation (see paper)
42% identity, 88% coverage: 23:221/227 of query aligns to 22:220/245 of 7tchB
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
41% identity, 96% coverage: 8:224/227 of query aligns to 11:226/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
41% identity, 95% coverage: 8:222/227 of query aligns to 8:221/222 of 7arlD
7mdyC Lolcde nucleotide-bound
41% identity, 96% coverage: 8:224/227 of query aligns to 8:223/226 of 7mdyC
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
41% identity, 96% coverage: 8:224/227 of query aligns to 10:225/229 of 7v8iD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
42% identity, 88% coverage: 23:222/227 of query aligns to 19:217/223 of 2pclA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
45% identity, 93% coverage: 14:224/227 of query aligns to 15:224/648 of P75831
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
42% identity, 99% coverage: 3:227/227 of query aligns to 4:228/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
42% identity, 99% coverage: 3:227/227 of query aligns to 4:228/592 of 5lj7A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 89% coverage: 22:224/227 of query aligns to 32:229/378 of P69874
Sites not aligning to the query:
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 93% coverage: 3:214/227 of query aligns to 4:213/330 of P9WQK5
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
42% identity, 89% coverage: 22:224/227 of query aligns to 16:217/240 of 4ymuJ
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 97% coverage: 3:223/227 of query aligns to 2:221/343 of P30750
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
35% identity, 92% coverage: 17:224/227 of query aligns to 14:220/229 of 6z67B
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
35% identity, 92% coverage: 17:224/227 of query aligns to 14:220/230 of 6z4wA
Sites not aligning to the query:
>5210215 FitnessBrowser__PV4:5210215
MTIAIQALTKIYNPESDFPVAAVKSLDLTIAQGEFVAIMGPSGSGKTTLLNMIGGIDSPS
SGAVFIDGEDITHLSEQALIAFRRDHVGFIFQDYSLLPVLTALENVEFVMQLQGHSEAEC
RDRAMALLAQVGLAAQQDKIPAKLSGGQQQRVAVARALAPRPRFVMADEPTANLDAKSTA
ELLDIMQSLNEQEGTTFIFSTHDPRVIARAKRVIVFEDGRLVEDRRQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory