SitesBLAST
Comparing 5210234 FitnessBrowser__PV4:5210234 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
7qh2B Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 78% coverage: 2:201/257 of query aligns to 3:201/265 of 7qh2B
- binding flavin-adenine dinucleotide: C7 (= C6), K9 (= K8), D39 (= D37), M62 (≠ V61), D94 (≠ L95), V95 (≠ P96), L102 (= L103), G118 (= G118), Q120 (≠ G120), T121 (≠ S121), T126 (≠ A126), A127 (≠ Q127), V129 (= V129)
6fahB Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
27% identity, 82% coverage: 1:212/257 of query aligns to 1:211/262 of 6fahB
- binding flavin-adenine dinucleotide: C6 (= C6), A7 (≠ Y7), K8 (= K8), D38 (= D37), T61 (≠ S60), M62 (≠ V61), A93 (≠ L94), D94 (≠ L95), T95 (≠ P96), T98 (= T99), L102 (= L103), G118 (= G118), Q120 (≠ G120), G124 (≠ L124), T126 (≠ A126), A127 (≠ Q127), V129 (= V129)
Sites not aligning to the query:
5ol2B The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
29% identity, 77% coverage: 1:197/257 of query aligns to 1:194/260 of 5ol2B
- binding flavin-adenine dinucleotide: C6 (= C6), I7 (≠ Y7), K8 (= K8), D38 (= D37), M61 (≠ V61), A92 (≠ L94), D93 (≠ L95), T94 (≠ P96), T97 (= T99), A115 (≠ C117), G116 (= G118), A119 (≠ S121), G122 (≠ L124), T124 (≠ A126), A125 (≠ Q127), V127 (= V129)
1efpB Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
28% identity, 94% coverage: 1:242/257 of query aligns to 1:241/246 of 1efpB
- binding adenosine monophosphate: P6 (≠ C6), V7 (≠ Y7), D39 (= D37), I63 (≠ V61), V101 (≠ T99), A119 (≠ C117), G120 (= G118), Q122 (≠ G120), A123 (≠ S121), N126 (≠ L124), M128 (≠ A126), N129 (≠ Q127), T131 (≠ V129)
- binding flavin-adenine dinucleotide: Y13 (≠ E12), L182 (≠ A181)
5ow0B Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
32% identity, 80% coverage: 1:205/257 of query aligns to 1:202/251 of 5ow0B
- binding adenosine monophosphate: L6 (≠ C6), A7 (≠ Y7), K8 (= K8), D39 (= D37), Y62 (≠ V61), I95 (≠ T99), A114 (≠ C117), G115 (= G118), Q117 (≠ G120), S118 (= S121), R123 (≠ A126), G124 (≠ Q127), V125 (≠ Q128), V126 (= V129), P127 (≠ G130)
- binding flavin-adenine dinucleotide: L37 (≠ P35), Y38 (≠ F36)
2a1uB Crystal structure of the human etf e165betaa mutant (see paper)
30% identity, 79% coverage: 26:229/257 of query aligns to 28:229/252 of 2a1uB
- binding adenosine monophosphate: C39 (≠ D37), C63 (≠ V61), V101 (≠ T99), L119 (≠ C117), G120 (= G118), Q122 (≠ G120), A123 (≠ S121), D126 (≠ L124), C128 (≠ A126), N129 (≠ Q127), Q130 (= Q128), T131 (≠ V129)
- binding flavin-adenine dinucleotide: P37 (= P35), L182 (≠ A181)
Sites not aligning to the query:
4l2iB Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
28% identity, 70% coverage: 1:179/257 of query aligns to 1:177/263 of 4l2iB
- binding flavin-adenine dinucleotide: C6 (= C6), V7 (≠ Y7), K8 (= K8), Y37 (≠ F36), D38 (= D37), Y40 (≠ N39), T60 (≠ S60), M61 (≠ V61), A92 (≠ L94), D93 (≠ L95), T94 (≠ P96), T97 (= T99), M101 (≠ L103), C116 (= C117), G117 (= G118), Q119 (≠ G120), A120 (≠ S121), G123 (≠ L124), T125 (≠ A126), A126 (≠ Q127), V128 (= V129)
- binding nicotinamide-adenine-dinucleotide: M61 (≠ V61), G62 (= G62), P63 (≠ G63), S85 (≠ I87), D86 (= D88), G91 (≠ A93)
4kpuB Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
28% identity, 70% coverage: 1:179/257 of query aligns to 1:177/263 of 4kpuB
- binding flavin-adenine dinucleotide: C6 (= C6), V7 (≠ Y7), K8 (= K8), Y37 (≠ F36), D38 (= D37), Y40 (≠ N39), M61 (≠ V61), A92 (≠ L94), D93 (≠ L95), T94 (≠ P96), T97 (= T99), C116 (= C117), G117 (= G118), Q119 (≠ G120), A120 (≠ S121), G123 (≠ L124), T125 (≠ A126), A126 (≠ Q127), V128 (= V129)
Q9DCW4 Electron transfer flavoprotein subunit beta; Beta-ETF from Mus musculus (Mouse) (see paper)
30% identity, 79% coverage: 26:229/257 of query aligns to 31:232/255 of Q9DCW4
- K200 (≠ A196) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate
- K203 (= K199) modified: N6,N6,N6-trimethyllysine; by ETFBKMT
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
P38117 Electron transfer flavoprotein subunit beta; Beta-ETF from Homo sapiens (Human) (see 10 papers)
30% identity, 77% coverage: 33:229/257 of query aligns to 38:232/255 of P38117
- NPFC 39:42 (≠ NPFD 34:37) binding
- C66 (≠ V61) binding
- 123:134 (vs. 118:129, 25% identical) binding
- D128 (= D123) to N: in GA2B; decreased protein stability; dbSNP:rs104894678
- T154 (≠ V149) to M: in dbSNP:rs1130426
- R164 (= R160) to Q: in GA2B; reduced electron transfer activity; dbSNP:rs104894677
- E165 (≠ A161) mutation E->A,Q: Drastically increases interprotein electron transfer rates.
- 183:205 (vs. 179:201, 30% identical) Recognition loop
- L195 (≠ M191) mutation to A: Severely impaired in complex formation with ACADM.
- K200 (≠ A196) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate; mutation to R: Does not abolish electron transfer activity. Decreases sensitivity to inhibition by lysine methyltransferase ETFBKMT.
- KAK 200:202 (≠ AAA 196:198) mutation to RAR: Does not abolish methylation by ETFBKMT.
- KAKK 200:203 (≠ AAAK 196:199) mutation to RAKR: Does not abolish electron transfer activity. Abolishes sensitivity to inhibition by lysine methyltransferase ETFBKMT.
- K203 (= K199) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; mutation to R: Does not abolish electron transfer activity. Decreases sensitivity to inhibition by lysine methyltransferase ETFBKMT.
Sites not aligning to the query:
Q2TBV3 Electron transfer flavoprotein subunit beta; Beta-ETF from Bos taurus (Bovine) (see paper)
30% identity, 79% coverage: 26:229/257 of query aligns to 31:232/255 of Q2TBV3
- K200 (≠ A196) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate
- K203 (= K199) modified: N6,N6,N6-trimethyllysine; by ETFBKMT
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
7koeA Electron bifurcating flavoprotein fix/etfabcx (see paper)
24% identity, 77% coverage: 3:199/257 of query aligns to 4:205/282 of 7koeA
- binding flavin-adenine dinucleotide: C7 (= C6), I8 (≠ Y7), K9 (= K8), D39 (= D37), M62 (≠ V61), A93 (≠ L94), D94 (≠ L95), T95 (≠ P96), T98 (= T99), L102 (= L103), T121 (≠ C117), G122 (= G118), A125 (≠ S121), G128 (≠ L124), T130 (≠ A126), G131 (≠ Q127), V133 (= V129)
P53570 Electron transfer flavoprotein subunit beta; Beta-ETF; Electron transfer flavoprotein small subunit; ETFSS from Methylophilus methylotrophus (Bacterium W3A1) (see paper)
23% identity, 83% coverage: 1:214/257 of query aligns to 1:217/264 of P53570
1o96A Structure of electron transferring flavoprotein for methylophilus methylotrophus. (see paper)
22% identity, 83% coverage: 1:214/257 of query aligns to 1:216/261 of 1o96A
- binding adenosine monophosphate: A6 (≠ C6), V7 (≠ Y7), K8 (= K8), D38 (= D37), V63 (≠ G62), V99 (≠ T99), A117 (≠ C117), G118 (= G118), Q120 (≠ G120), S121 (= S121), Y126 (≠ A126), A127 (≠ Q127), T129 (≠ V129)
- binding flavin-adenine dinucleotide: Q120 (≠ G120), Q182 (≠ S180)
Query Sequence
>5210234 FitnessBrowser__PV4:5210234
MKIITCYKLVPEEQDISVNGDGSLDTNKAAPKINPFDLNAVEAGVQLKAMVEGSQLTALS
VGGKALDNPKARKDILSRGPDDLTLVIDEQFGALLPHQTARVLASAARQCEFDLILCGDG
SGDLFAQQVGMQLGELLNVSCINAVSKIVSATDSTLTVERALDDEVEVLEIDLPAVISVS
ADINEPQIPSMKTILAAAKKPVTTLDTQALALEALPKLVDAISVVAPKQAERAQIIVEGD
DEAQIAAFADHLRKAMN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory