SitesBLAST
Comparing 5210235 FitnessBrowser__PV4:5210235 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
31% identity, 99% coverage: 1:311/313 of query aligns to 62:388/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (= L108), R200 (≠ H125), M281 (≠ S203), G282 (= G204), R307 (= R229), A308 (≠ P230), Q320 (≠ Y243), V321 (= V244), G322 (= G245), Q323 (≠ V246), T324 (≠ S247), G337 (= G260), I338 (= I261), S339 (= S262), Q343 (= Q266), H344 (= H267), N358 (= N281), K359 (= K282), L377 (≠ I300)
Sites not aligning to the query:
- binding iron/sulfur cluster: 7, 10, 13, 17, 18, 35, 36, 37, 38, 41, 45, 49
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
33% identity, 90% coverage: 30:311/313 of query aligns to 36:324/331 of 5ol2A
- binding calcium ion: E75 (= E66), D188 (≠ K174)
- binding flavin-adenine dinucleotide: T117 (≠ I109), R136 (vs. gap), I147 (vs. gap), G216 (= G202), R217 (≠ S203), G218 (= G204), S242 (= S228), R243 (= R229), A244 (≠ P230), Q256 (≠ Y243), V257 (= V244), G258 (= G245), T260 (≠ S247), G273 (= G260), I274 (= I261), S275 (= S262), A277 (≠ Q264), Q279 (= Q266), H280 (= H267), N294 (= N281), K295 (= K282), D312 (= D299), V313 (≠ I300)
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
30% identity, 80% coverage: 63:312/313 of query aligns to 47:292/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G202), R184 (≠ S203), G185 (= G204), S209 (= S228), R210 (= R229), Q223 (≠ Y243), I224 (≠ V244), G225 (= G245), T227 (≠ S247), G240 (= G260), V241 (≠ I261), S242 (= S262), A244 (≠ Q264), Q246 (= Q266), H247 (= H267), N261 (= N281), K262 (= K282), D279 (= D299), Y280 (≠ I300)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
29% identity, 92% coverage: 27:313/313 of query aligns to 42:333/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (= L108), T126 (≠ I109), R144 (vs. gap), I155 (= I133), R224 (≠ S203), G225 (= G204), T249 (≠ S228), R250 (= R229), Q263 (≠ Y243), I264 (≠ V244), G265 (= G245), L266 (≠ V246), S267 (= S247), G280 (= G260), I281 (= I261), S282 (= S262), Q286 (= Q266), N301 (= N281), S302 (≠ K282), D303 (= D283), D319 (= D299), L320 (≠ I300)
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
32% identity, 70% coverage: 88:307/313 of query aligns to 89:303/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G202), R200 (≠ S203), G201 (= G204), S225 (= S228), R226 (= R229), A227 (≠ P230), Q239 (≠ Y243), V240 (= V244), G241 (= G245), T243 (≠ S247), G256 (= G260), I257 (= I261), S258 (= S262), A260 (≠ Q264), Q262 (= Q266), H263 (= H267), N277 (= N281), K278 (= K282), D295 (= D299), L296 (≠ I300)
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
30% identity, 70% coverage: 94:312/313 of query aligns to 99:313/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G202), R205 (≠ S203), S230 (= S228), R231 (= R229), A232 (≠ P230), Q244 (≠ Y243), V245 (= V244), G246 (= G245), T248 (≠ S247), G261 (= G260), I262 (= I261), S263 (= S262), A265 (≠ Q264), Q267 (= Q266), H268 (= H267), N282 (= N281), K283 (= K282), D300 (= D299), L301 (≠ I300)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
30% identity, 70% coverage: 94:312/313 of query aligns to 117:331/333 of P13804
- T171 (≠ G150) to I: decreased protein stability; dbSNP:rs1801591
- R223 (≠ S203) binding
- S248 (= S228) binding
- R249 (= R229) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (≠ VGVS 244:247) binding
- T266 (≠ S247) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (≠ SGQIQH 262:267) binding
- N300 (= N281) binding
- DL 318:319 (≠ DI 299:300) binding
Sites not aligning to the query:
- 20:204 Domain I
- 116 G → R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- 205:333 Domain II
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
30% identity, 86% coverage: 45:312/313 of query aligns to 77:333/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (= L108), R144 (≠ H125), I155 (vs. gap), G224 (= G202), R225 (≠ S203), G226 (= G204), S250 (= S228), R251 (= R229), A252 (≠ I231), Q264 (≠ Y243), V265 (= V244), G266 (= G245), Q267 (≠ V246), S268 (= S247), G281 (= G260), I282 (= I261), S283 (= S262), S285 (≠ Q264), Q287 (= Q266), H288 (= H267), N302 (= N281), K303 (= K282), D320 (= D299), A321 (≠ I300)
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
31% identity, 96% coverage: 12:312/313 of query aligns to 31:328/336 of 7koeB
- binding flavin-adenine dinucleotide: T121 (≠ I109), R140 (≠ H125), T142 (≠ V127), G219 (= G202), K220 (≠ S203), G221 (= G204), S245 (= S228), R246 (= R229), A247 (≠ P230), Q259 (≠ Y243), V260 (= V244), G261 (= G245), Q262 (≠ V246), T263 (≠ S247), G276 (= G260), S278 (= S262), Q282 (= Q266), H283 (= H267), N297 (= N281), I298 (≠ K282), L316 (≠ I300)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
30% identity, 87% coverage: 29:300/313 of query aligns to 35:308/321 of P53571
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
30% identity, 87% coverage: 29:300/313 of query aligns to 34:307/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G202), R210 (≠ S203), G211 (= G204), S235 (= S228), A236 (≠ R229), P237 (= P230), Q249 (≠ Y243), V250 (= V244), G251 (= G245), Q252 (≠ V246), S253 (= S247), G267 (= G260), I268 (= I261), S269 (= S262), S271 (≠ Q264), Q273 (= Q266), H274 (= H267), N288 (= N281), T289 (≠ K282), D306 (= D299), I307 (= I300)
Query Sequence
>5210235 FitnessBrowser__PV4:5210235
MSKLSNVWVFSDIATRLPETIAGGRALGEKVSAFIIGSEADIATAYSYGATHVYYLGNKA
DAQMVEDYAATMSQAINDGDKPTLVLLPATKRCKALAAKLSVQLEAGLINDATEVSLDEG
VTAKHMVYGGLAIGTERITSPVALVTLASGAFEPQAADTSLTGEGVSLAFVAPKQAIRCI
ERRVKQGNSVDLGKAKRVIAVGSGIGNLDNLALAGELATAIQAELGCSRPIAETEKWMER
ERYVGVSGVMLKPDIYLALGISGQIQHMVGALGSQTILAVNKDKNAPIFQYVDYGLVGDI
NKVLPALIQAMKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory