Comparing 5210245 FitnessBrowser__PV4:5210245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
37% identity, 92% coverage: 29:439/445 of query aligns to 6:393/398 of 6slfA
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
35% identity, 83% coverage: 28:396/445 of query aligns to 2:351/389 of 4ewtA
Sites not aligning to the query:
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 75% coverage: 49:380/445 of query aligns to 55:372/440 of O04373
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
32% identity, 80% coverage: 42:395/445 of query aligns to 10:342/380 of P54955
Sites not aligning to the query:
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 84% coverage: 48:423/445 of query aligns to 58:408/442 of P54968
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
25% identity, 75% coverage: 42:374/445 of query aligns to 8:319/373 of 3rzaA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
24% identity, 75% coverage: 49:383/445 of query aligns to 25:315/391 of 3ramA
Sites not aligning to the query:
>5210245 FitnessBrowser__PV4:5210245
MLRQIIHQSCLAGALVALGTSQSLWAQDEALSQSVKQAMPALSSLYLELHQAPELSYHEQ
QSGERMAAEFEALGIEVTRDFGGHGVVGIYRNGKGPTVMLRADTDALPIVEETGKAYASK
VTTLDAQGNQVGVMHACGHDVHMTNLVGTAQQLIQQKDKWQGTLMLVAQPAEEVGGGAKA
MLKQGLFSQFPTPDHILGLHVSASVPAGKVAIAPGYALANVDSVDISVKGRGGHGAYPHT
TVDPVVLAARIVLALQTIVSREVSPLSPNVITVGSIHGGSKHNIIGNEVKLQLTLRSYDP
KVREQQIAAIERLTKGIAISAGLSEAEWPDVYVHQEESIPSTYNDPEQTAKVRASIAKQL
GDDNVLEASPVMAGEDFGLYGLTPAKRPITLFWLGAVPAVDYAASQASGASLPSLHSSKF
APDYPVTIEAGVQAMSRAALDLFKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory