Comparing 5210330 FitnessBrowser__PV4:5210330 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A7B3 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Escherichia coli (strain K12) (see paper)
57% identity, 100% coverage: 1:292/292 of query aligns to 1:292/292 of P0A7B3
7mh7A Crystal structure of NAD kinase from pseudomonas aeruginosa pao1
49% identity, 99% coverage: 3:291/292 of query aligns to 1:290/290 of 7mh7A
P9WHV7 NAD kinase; ATP-dependent NAD kinase; Poly(P)-dependent NAD kinase; PPNK; EC 2.7.1.23 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
36% identity, 74% coverage: 47:262/292 of query aligns to 59:274/307 of P9WHV7
Sites not aligning to the query:
1y3iA Crystal structure of mycobacterium tuberculosis NAD kinase-NAD complex (see paper)
37% identity, 66% coverage: 70:262/292 of query aligns to 12:203/231 of 1y3iA
Q9P7K3 Uncharacterized kinase C24B10.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 97% coverage: 7:288/292 of query aligns to 99:407/449 of Q9P7K3
Sites not aligning to the query:
3afoA Crystal structure of yeast nadh kinase complexed with nadh
33% identity, 67% coverage: 64:260/292 of query aligns to 112:315/360 of 3afoA
O13863 Uncharacterized kinase C1B1.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 80% coverage: 58:290/292 of query aligns to 274:514/537 of O13863
Sites not aligning to the query:
1z0zA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with NAD (see paper)
33% identity, 65% coverage: 61:250/292 of query aligns to 38:222/249 of 1z0zA
1z0sA Crystal structure of an NAD kinase from archaeoglobus fulgidus in complex with atp (see paper)
33% identity, 65% coverage: 61:250/292 of query aligns to 38:222/249 of 1z0sA
Sites not aligning to the query:
1suwA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with its substrate and product: insights into the catalysis of NAD kinase (see paper)
33% identity, 65% coverage: 61:250/292 of query aligns to 38:222/249 of 1suwA
O30297 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
33% identity, 65% coverage: 61:250/292 of query aligns to 38:222/249 of O30297
6rbzA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
30% identity, 62% coverage: 64:245/292 of query aligns to 37:220/262 of 6rbzA
7zzdA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
30% identity, 62% coverage: 64:245/292 of query aligns to 37:220/262 of 7zzdA
Sites not aligning to the query:
7zz9A Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
30% identity, 62% coverage: 64:245/292 of query aligns to 37:220/262 of 7zz9A
6z64A Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a di-adenosine derivative (see paper)
30% identity, 62% coverage: 64:245/292 of query aligns to 37:220/262 of 6z64A
3v8nA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with 8-bromo-5'-amino-5'-deoxyadenosine, reacted with a citrate molecule in n site (see paper)
31% identity, 62% coverage: 64:245/292 of query aligns to 37:215/257 of 3v8nA
5dhuA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
30% identity, 62% coverage: 64:245/292 of query aligns to 37:221/263 of 5dhuA
Sites not aligning to the query:
5dhtA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
30% identity, 62% coverage: 64:245/292 of query aligns to 37:221/263 of 5dhtA
5dhsA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
30% identity, 62% coverage: 64:245/292 of query aligns to 37:221/263 of 5dhsA
Sites not aligning to the query:
5dhrA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a novel inhibitor (see paper)
30% identity, 62% coverage: 64:245/292 of query aligns to 37:221/263 of 5dhrA
Sites not aligning to the query:
>5210330 FitnessBrowser__PV4:5210330
MSKAFHSIGLIGKPHHSGTHKTLKRLHHWLTMQSYDVYVEERVAAEIGPQVKSVDLLQIG
EYCDLAIVVGGDGNMLGAARVLARFDIGVIGVNRGNLGFLTDLPPDTFEEALGKVLQGEY
ETEHRFLLESEVHRHGEMKSSNTAVNEAVLHPGKIAHMIEFEVYIDDKFMYSQRADGMIV
STPTGSTAYSLSAGGAILTPNLEALILVPMFPHTLSCRPIVVDACSIIKLVVSPDNGDAL
EVSCDGHVTLPVLPGDEIIVRRSKERLRLIHPKGYNYFHVLRNKLGWGSKLF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory