SitesBLAST
Comparing 5210367 FitnessBrowser__PV4:5210367 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O53289 Phosphoserine phosphatase SerB2; PSP; PSPase; O-phosphoserine phosphohydrolase; Protein-serine/threonine phosphatase; EC 3.1.3.3; EC 3.1.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
46% identity, 62% coverage: 120:323/327 of query aligns to 181:384/409 of O53289
- D185 (= D124) mutation to G: Completely abolishes enzymatic activity.; mutation to N: Completely abolishes enzymatic activity.
- V186 (≠ M125) mutation to Q: Decreases enzymatic activity by 50%.
- D187 (= D126) mutation to N: Decreases enzymatic activity by 15%.
- S188 (= S127) mutation to A: No effect on enzymatic activity.
- S273 (= S212) mutation to A: Completely abolishes enzymatic activity (PubMed:25521849). Decreases enzymatic activity by 60% (PubMed:25037224).
- K318 (= K257) mutation to A: Decreases enzymatic activity by 50%.; mutation to E: Completely abolishes enzymatic activity.
- D341 (= D280) mutation to G: Decreases enzymatic activity by 80%.; mutation to N: Decreases enzymatic activity by 85%. Completely abolishes enzymatic activity, does not elicit cytoskeletal rearrangements, and does not suppress IL-8 production after TNF-alpha stimulation; when associated with N-345.
- D345 (= D284) mutation to N: Decreases enzymatic activity by 55%. Completely abolishes enzymatic activity, does not elicit cytoskeletal rearrangements, and does not suppress IL-8 production after TNF-alpha stimulation; when associated with N-341.
Sites not aligning to the query:
- 18 G→A: Does not bind L-serine and correspondingly no oligomeric transitions is observed in the presence of L-serine.
- 108 G→A: Does not bind L-serine and correspondingly no oligomeric transitions is observed in the presence of L-serine.
5jlpA Crystal structure of mycobacterium avium serb2 in complex with serine at act domain
46% identity, 62% coverage: 120:323/327 of query aligns to 179:382/396 of 5jlpA
Sites not aligning to the query:
8a21A Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with phenylimidazole (see paper)
46% identity, 62% coverage: 120:323/327 of query aligns to 179:382/396 of 8a21A
- binding magnesium ion: D183 (= D124), D185 (= D126), D339 (= D280)
- binding 4-phenyl-1h-imidazole: D185 (= D126), E192 (= E133), V193 (≠ C134), I194 (= I135), T211 (= T152), M215 (= M156), F221 (= F162), R228 (= R169), G273 (= G214)
Sites not aligning to the query:
8a1zA Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with 1-(2,4-dichlorophenyl)-3-hydroxyurea (see paper)
46% identity, 62% coverage: 120:323/327 of query aligns to 179:382/396 of 8a1zA
- binding 1-(2,4-dichlorophenyl)-3-oxidanyl-urea: D185 (= D126), E192 (= E133), M215 (= M156), F221 (= F162), L225 (= L166), R228 (= R169), G272 (= G213), F274 (= F215), D339 (= D280)
- binding magnesium ion: D183 (= D124), D185 (= D126), D339 (= D280)
A0QJI1 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Mycobacterium avium (strain 104) (see paper)
46% identity, 62% coverage: 120:323/327 of query aligns to 183:386/411 of A0QJI1
- D187 (= D124) binding
- D189 (= D126) binding
- D343 (= D280) binding
1l7nA Transition state analogue of phosphoserine phosphatase (aluminum fluoride complex) (see paper)
40% identity, 63% coverage: 117:322/327 of query aligns to 2:208/209 of 1l7nA
- active site: D9 (= D124), F10 (≠ M125), D11 (= D126), G98 (= G213), K142 (= K257), D169 (= D284)
- binding aluminum fluoride: D9 (= D124), F10 (≠ M125), D11 (= D126), S97 (= S212), K142 (= K257)
- binding tetrafluoroaluminate ion: D9 (= D124), F10 (≠ M125), D11 (= D126), S97 (= S212), G98 (= G213), K142 (= K257), N168 (= N283)
- binding magnesium ion: D9 (= D124), D11 (= D126), D165 (= D280)
1f5sA Crystal structure of phosphoserine phosphatase from methanococcus jannaschii (see paper)
40% identity, 63% coverage: 117:322/327 of query aligns to 3:209/210 of 1f5sA
- active site: D10 (= D124), F11 (≠ M125), D12 (= D126), G99 (= G213), K143 (= K257), D170 (= D284)
- binding magnesium ion: D10 (= D124), D12 (= D126), D166 (= D280)
- binding phosphate ion: D10 (= D124), F11 (≠ M125), D12 (= D126), S98 (= S212), G99 (= G213), K143 (= K257)
Q58989 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see 3 papers)
40% identity, 63% coverage: 117:322/327 of query aligns to 4:210/211 of Q58989
- D11 (= D124) active site, Nucleophile; binding ; mutation to N: Loss of activity.
- D13 (= D126) active site, Proton donor; binding
- E20 (= E133) binding
- R56 (= R169) binding
- SG 99:100 (= SG 212:213) binding
- K144 (= K257) binding
- D167 (= D280) binding
- N170 (= N283) binding
1l7pA Substrate bound phosphoserine phosphatase complex structure (see paper)
40% identity, 63% coverage: 117:322/327 of query aligns to 1:207/208 of 1l7pA
- active site: N8 (≠ D124), F9 (≠ M125), D10 (= D126), G97 (= G213), K141 (= K257), D168 (= D284)
- binding phosphoserine: N8 (≠ D124), F9 (≠ M125), D10 (= D126), E17 (= E133), M40 (= M156), F46 (= F162), R53 (= R169), S96 (= S212), G97 (= G213), K141 (= K257)
7qplA Crystal structure of phosphoserine phosphatase (serb) from brucella melitensis in complex with phosphate and magnesium
37% identity, 76% coverage: 76:322/327 of query aligns to 38:285/295 of 7qplA
1l7oA Crystal structure of phosphoserine phosphatase in apo form (see paper)
38% identity, 63% coverage: 117:322/327 of query aligns to 1:199/200 of 1l7oA
3m1yC Crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori
36% identity, 61% coverage: 120:319/327 of query aligns to 5:203/208 of 3m1yC
P78330 Phosphoserine phosphatase; PSP; PSPase; L-3-phosphoserine phosphatase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Homo sapiens (Human) (see 4 papers)
33% identity, 54% coverage: 121:297/327 of query aligns to 17:196/225 of P78330
- D20 (= D124) binding
- DVD 20:22 (≠ DMD 124:126) binding
- D22 (= D126) binding
- S23 (= S127) mutation to A: Reduces L-phosphoserine phosphatase activity by about 50%.; mutation to T: Reduces L-phosphoserine phosphatase activity by about 80%.
- E29 (= E133) mutation to D: Reduces L-phosphoserine phosphatase activity by about 95%.; mutation to Q: Loss of L-phosphoserine phosphatase activity.
- D32 (= D136) to N: in PSPHD; decreased L-phosphoserine phosphatase activity; dbSNP:rs104894035
- A35 (= A139) to T: in PSPHD; decreased L-phosphoserine phosphatase activity
- M52 (= M156) binding ; to T: in PSPHD; decreased L-phosphoserine phosphatase activity; dbSNP:rs104894036
- G53 (≠ Q157) binding
- R65 (= R169) mutation R->A,K: Loss of L-phosphoserine phosphatase activity.
- SGG 109:111 (= SGG 212:214) binding ; binding
- N133 (= N234) mutation to A: Reduces L-phosphoserine phosphatase activity by about 75%.
- K158 (= K257) binding ; binding
- D179 (= D280) binding
- T182 (≠ N283) binding ; binding ; mutation to S: Reduces L-phosphoserine phosphatase activity by about 99%.; mutation to V: Reduces L-phosphoserine phosphatase activity by about 25%.
Sites not aligning to the query:
- 202 R→A: Reduces L-phosphoserine phosphatase activity by about 99%.; R→K: Reduces L-phosphoserine phosphatase activity by about 95%.
6q6jB Human phosphoserine phosphatase with substrate analogue homo-cysteic acid (see paper)
33% identity, 54% coverage: 121:297/327 of query aligns to 13:192/217 of 6q6jB
- binding calcium ion: D16 (= D124), D18 (= D126), D175 (= D280)
- binding (2~{S})-2-azanyl-4-sulfo-butanoic acid: D16 (= D124), V17 (≠ M125), D18 (= D126), F54 (= F162), S105 (= S212), G106 (= G213), G107 (= G214), K154 (= K257), T178 (≠ N283)
6hyjB Psph human phosphoserine phosphatase (see paper)
33% identity, 54% coverage: 121:297/327 of query aligns to 17:196/223 of 6hyjB
Sites not aligning to the query:
1l8oA Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase (see paper)
33% identity, 54% coverage: 121:297/327 of query aligns to 14:193/222 of 1l8oA
Sites not aligning to the query:
1l8lA Molecular basis for the local confomational rearrangement of human phosphoserine phosphatase (see paper)
33% identity, 54% coverage: 121:297/327 of query aligns to 14:193/222 of 1l8lA
- active site: D17 (= D124), V18 (≠ M125), D19 (= D126), G107 (= G213), K155 (= K257), D180 (= D284)
- binding d-2-amino-3-phosphono-propionic acid: D17 (= D124), D19 (= D126), G107 (= G213), K155 (= K257), D176 (= D280), G177 (= G281), T179 (≠ N283)
6hyyA Human phosphoserine phosphatase with serine and phosphate (see paper)
33% identity, 54% coverage: 121:297/327 of query aligns to 13:192/221 of 6hyyA
4ap9A Crystal structure of phosphoserine phosphatase from t.Onnurineus in complex with ndsb-201 (see paper)
28% identity, 54% coverage: 122:296/327 of query aligns to 13:174/200 of 4ap9A
- active site: D15 (= D124), I16 (≠ M125), E17 (≠ D126), G103 (= G213), K141 (= K257), D162 (= D284)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: R31 (≠ A140), I32 (≠ M141), T33 (≠ A142), L46 (≠ M156), W52 (≠ F162), D140 (vs. gap), K141 (= K257), Y160 (≠ A282), A161 (≠ N283)
6iuyA Structure of dsgpdh of dunaliella salina (see paper)
25% identity, 60% coverage: 121:315/327 of query aligns to 17:217/585 of 6iuyA
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 233, 234, 235, 236, 268, 290, 321, 324, 349, 381, 382, 497, 529, 530, 532
Query Sequence
>5210367 FitnessBrowser__PV4:5210367
MAYQQQNPLFSWLYDEVSASLTLDGCQLTRHEEASAPNADLRLRLVYQGTQCQAIIAEQL
LSSATSVSIALITRQNDLTCIELCLDKQVGQKLADALAARDDIELLYIGDQQPRLDRPGL
LVMDMDSTAIQIECIDELAAMAGVGEAVAEVTERAMQGELDFEQSLRERVAKLAGADAGI
IDTLCAQLPLMPGLEAMVAELQDYGWRLVLASGGFTPFVGHLKQQLNLDAAYANELVIVE
GKLKGEVIGTVVDAQFKADTVLRSAESWQIPMGQRLAIGDGANDIPMVQAADFGIAYHAK
PKLKAAADAAIAKLDLRVLPYMLVNLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory