SitesBLAST
Comparing 5210391 FitnessBrowser__PV4:5210391 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P31120 Phosphoglucosamine mutase; EC 5.4.2.10 from Escherichia coli (strain K12) (see 3 papers)
67% identity, 100% coverage: 2:442/443 of query aligns to 4:445/445 of P31120
- S100 (= S98) mutation to A: 2% of wild-type activity.; mutation to T: 20-fold increase in the non-specific phosphoglucomutase activity towards glucose-phosphate substrates (non aminated).
- S102 (= S100) active site, Phosphoserine intermediate; modified: Phosphoserine; by autocatalysis; mutation to A: Loss of activity in the absence or presence of glucosamine-1,6-diP.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7omlA Bacillus subtilis phosphoglucomutase glmm (metal bound) (see paper)
43% identity, 99% coverage: 3:441/443 of query aligns to 2:442/445 of 7omlA
7ojrA Bacillus subtilis phosphoglucomutase glmm (phosphate bound) (see paper)
43% identity, 99% coverage: 3:441/443 of query aligns to 2:442/445 of 7ojrA
3i3wA Structure of a phosphoglucosamine mutase from francisella tularensis
44% identity, 99% coverage: 3:440/443 of query aligns to 1:437/441 of 3i3wA
- active site: R9 (= R11), S99 (= S100), H100 (= H101), K109 (= K110), D237 (= D239), D239 (= D241), D241 (= D243), R242 (= R244), H324 (= H327)
- binding zinc ion: S99 (= S100), D237 (= D239), D239 (= D241), D241 (= D243)
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
34% identity, 98% coverage: 1:433/443 of query aligns to 1:444/455 of 1wqaA
- active site: R11 (= R11), S101 (= S100), H102 (= H101), K111 (= K110), D243 (= D239), D245 (= D241), D247 (= D243), R248 (= R244), G330 (≠ H327), R340 (≠ G337)
- binding magnesium ion: S101 (= S100), D243 (= D239), D245 (= D241), D247 (= D243)
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
26% identity, 98% coverage: 10:442/443 of query aligns to 11:447/455 of 2h5aX
- active site: H101 (= H101), D234 (= D239), D236 (= D241), D238 (= D243), R239 (= R244), D332 (≠ G337)
- binding 1-O-phosphono-alpha-D-xylopyranose: T298 (≠ V304), G299 (= G305), H300 (≠ D306), E317 (= E323), S319 (= S325), H321 (= H327), R413 (= R408), S415 (= S410), N416 (≠ G411), T417 (= T412)
- binding zinc ion: S100 (= S100), D234 (= D239), D236 (= D241), D238 (= D243)
Sites not aligning to the query:
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
26% identity, 98% coverage: 10:442/443 of query aligns to 11:447/455 of 2h4lX
- active site: H101 (= H101), D234 (= D239), D236 (= D241), D238 (= D243), R239 (= R244), D332 (≠ G337)
- binding 1-O-phosphono-alpha-D-ribofuranose: R12 (= R11), S100 (= S100), T298 (≠ V304), E317 (= E323), R413 (= R408), S415 (= S410), N416 (≠ G411), T417 (= T412)
- binding zinc ion: S100 (= S100), D234 (= D239), D236 (= D241), D238 (= D243)
Sites not aligning to the query:
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
26% identity, 98% coverage: 10:442/443 of query aligns to 11:447/455 of 2fkfA
- active site: R12 (= R11), S100 (= S100), H101 (= H101), K110 (= K110), D234 (= D239), D236 (= D241), D238 (= D243), R239 (= R244), H321 (= H327), D332 (≠ G337)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: H101 (= H101), S319 (= S325), R413 (= R408), S415 (= S410), N416 (≠ G411), T417 (= T412)
- binding zinc ion: S100 (= S100), D234 (= D239), D236 (= D241), D238 (= D243)
Sites not aligning to the query:
1pcmX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
26% identity, 98% coverage: 10:442/443 of query aligns to 11:447/455 of 1pcmX
- active site: R12 (= R11), S100 (= S100), H101 (= H101), K110 (= K110), D234 (= D239), D236 (= D241), D238 (= D243), R239 (= R244), H321 (= H327), D332 (≠ G337)
- binding 6-O-phosphono-alpha-D-mannopyranose: S100 (= S100), T298 (≠ V304), G299 (= G305), H300 (≠ D306), E317 (= E323), S319 (= S325), H321 (= H327), R413 (= R408), S415 (= S410)
- binding zinc ion: S100 (= S100), D234 (= D239), D236 (= D241), D238 (= D243)
Sites not aligning to the query:
1p5gX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
26% identity, 98% coverage: 10:442/443 of query aligns to 11:447/455 of 1p5gX
- active site: R12 (= R11), S100 (= S100), H101 (= H101), K110 (= K110), D234 (= D239), D236 (= D241), D238 (= D243), R239 (= R244), H321 (= H327), D332 (≠ G337)
- binding 6-O-phosphono-alpha-D-glucopyranose: S100 (= S100), K277 (≠ A291), G299 (= G305), H300 (≠ D306), E317 (= E323), S319 (= S325), H321 (= H327), R413 (= R408), S415 (= S410), N416 (≠ G411), T417 (= T412)
- binding zinc ion: S100 (= S100), D234 (= D239), D236 (= D241), D238 (= D243)
Sites not aligning to the query:
1p5dX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
26% identity, 98% coverage: 10:442/443 of query aligns to 11:447/455 of 1p5dX
- active site: R12 (= R11), S100 (= S100), H101 (= H101), K110 (= K110), D234 (= D239), D236 (= D241), D238 (= D243), R239 (= R244), H321 (= H327), D332 (≠ G337)
- binding 1-O-phosphono-alpha-D-glucopyranose: S100 (= S100), R239 (= R244), T298 (≠ V304), G299 (= G305), H300 (≠ D306), E317 (= E323), S319 (= S325), H321 (= H327), R413 (= R408), S415 (= S410), T417 (= T412)
- binding zinc ion: S100 (= S100), D234 (= D239), D236 (= D241), D238 (= D243)
Sites not aligning to the query:
1pcjX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
26% identity, 98% coverage: 10:442/443 of query aligns to 14:450/458 of 1pcjX
- active site: R15 (= R11), S103 (= S100), H104 (= H101), K113 (= K110), D237 (= D239), D239 (= D241), D241 (= D243), R242 (= R244), H324 (= H327), D335 (≠ G337)
- binding 1-O-phosphono-alpha-D-mannopyranose: S103 (= S100), T301 (≠ V304), G302 (= G305), E320 (= E323), S322 (= S325), H324 (= H327), R416 (= R408), S418 (= S410), N419 (≠ G411), T420 (= T412)
- binding zinc ion: S103 (= S100), D237 (= D239), D239 (= D241), D241 (= D243)
Sites not aligning to the query:
P26276 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 10 papers)
26% identity, 98% coverage: 10:442/443 of query aligns to 19:455/463 of P26276
- R20 (= R11) mutation to A: No phosphoglucomutase activity.
- S108 (= S100) binding via phosphate group; modified: Phosphoserine; mutation S->A,V: About 5% activity, still subject to substrate inhibition and requires G1,6P as an activator; phosphorylation occurs at a different site.; mutation to C: KM for G1P unchanged, kcat decreases 24-fold; G1,6P stimulates reaction by 2-3 orders of magnitude. No stable protein phosphorylation detected, altered ligation of metal residue.
- N110 (= N102) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 30-fold.
- D242 (= D239) binding
- D244 (= D241) binding
- D246 (= D243) binding
- R247 (= R244) mutation to A: Small reduction in KM, small increase in dissociation of G1,6P intermediate.
- R262 (≠ E259) mutation to A: Increases KM 2-fold, decreases kcat 9-fold for G1P. Alters flexibility of the hinge region.
- K285 (≠ A291) binding
- H308 (≠ D306) binding ; binding
- E325 (= E323) mutation to A: Reduces KM and Vmax approximately 2-fold.
- EMSGH 325:329 (≠ ENSGH 323:327) binding ; binding
- H329 (= H327) mutation to A: No phosphoglucomutase activity using G1P as substrate, protein is less easily phosphorylated, no significant change in structure.
- P368 (≠ K365) mutation to G: Increases KM 2-fold, decreases kcat 6-fold for G1P. Alters flexibility of the hinge region, structure is less compact.
- R421 (= R408) mutation to C: Loss of phosphomannomutase activity, very low phosphoglucomutase activity.
- RASNT 421:425 (≠ RKSGT 408:412) binding ; binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 15 R→A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 25-fold.
- 17 binding ; binding
Q02E40 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
26% identity, 98% coverage: 10:442/443 of query aligns to 19:455/463 of Q02E40
- S108 (= S100) active site, Non-phosphorylated intermediate; modified: Phosphoserine
1k2yX Crystal structure of phosphomannomutase/phosphoglucomutase s108a mutant from p. Aeruginosa (see paper)
26% identity, 98% coverage: 10:442/443 of query aligns to 15:451/459 of 1k2yX
4il8A Crystal structure of an h329a mutant of p. Aeruginosa pmm/pgm (see paper)
26% identity, 98% coverage: 10:442/443 of query aligns to 15:451/459 of 4il8A
- active site: R16 (= R11), S104 (= S100), H105 (= H101), K114 (= K110), D238 (= D239), D240 (= D241), D242 (= D243), R243 (= R244), A325 (≠ H327), D336 (≠ G337)
- binding magnesium ion: S104 (= S100), D238 (= D239), D240 (= D241), D242 (= D243)
3uw2A X-ray crystal structure of phosphoglucomutase/phosphomannomutase family protein (bth_i1489)from burkholderia thailandensis (see paper)
26% identity, 95% coverage: 2:421/443 of query aligns to 4:429/458 of 3uw2A
- active site: R13 (= R11), S109 (= S100), H110 (= H101), K119 (= K110), D243 (= D239), D245 (= D241), D247 (= D243), R248 (= R244), H330 (= H327)
- binding zinc ion: D243 (= D239), D245 (= D241), D247 (= D243)
6mlwA Crystal structure of x. Citri phosphoglucomutase in complex with 2- fluoro mannosyl-1-methyl-phosphonic acid (see paper)
26% identity, 95% coverage: 5:425/443 of query aligns to 7:434/449 of 6mlwA
- active site: R13 (= R11), S98 (= S100), H99 (= H101), K108 (= K110), D238 (= D239), D240 (= D241), D242 (= D243), R243 (= R244), H325 (= H327)
- binding 2,6-anhydro-5,7-dideoxy-5-fluoro-7-phosphono-D-glycero-D-manno-heptitol: G303 (= G305), H304 (≠ D306), E321 (= E323), S323 (= S325), H325 (= H327), R415 (= R408), S417 (= S410), N418 (≠ G411), T419 (= T412), R424 (= R417)
- binding magnesium ion: S98 (= S100), D238 (= D239), D240 (= D241), D242 (= D243)
5bmpA Crystal structure of phosphoglucomutase from xanthomonas citri complexed with glucose-1-phosphate (see paper)
26% identity, 95% coverage: 5:425/443 of query aligns to 7:434/449 of 5bmpA
- active site: R13 (= R11), S98 (= S100), H99 (= H101), K108 (= K110), D238 (= D239), D240 (= D241), D242 (= D243), R243 (= R244), H325 (= H327)
- binding 1-O-phosphono-alpha-D-glucopyranose: R281 (≠ G287), G303 (= G305), E321 (= E323), S323 (= S325), H325 (= H327), R415 (= R408), S417 (= S410), N418 (≠ G411), T419 (= T412), R424 (= R417)
- binding magnesium ion: S98 (= S100), D238 (= D239), D240 (= D241), D242 (= D243)
3rsmA Crystal structure of s108c mutant of pmm/pgm (see paper)
24% identity, 96% coverage: 19:442/443 of query aligns to 6:428/436 of 3rsmA
- active site: C87 (≠ S100), K91 (= K110), D215 (= D239), D217 (= D241), D219 (= D243), R220 (= R244), H302 (= H327), D313 (≠ G337)
- binding phosphate ion: C87 (≠ S100), D215 (= D239), D217 (= D241), D219 (= D243), R220 (= R244)
- binding zinc ion: D215 (= D239), D217 (= D241), D219 (= D243)
Query Sequence
>5210391 FitnessBrowser__PV4:5210391
MRKFFGTDGIRGKVGAGKMTPELALKLGWAAGRVLSRTGTKKVIIGKDTRISGYLFESAM
EAGLSAAGLNVMLMGPMPTPAVAYLTRTFRAEAGVVISASHNPYYDNGIKFFSTDGSKLD
DEVELEIERELEKPLECVESHLLGKVSRIEDAAGRYIEYCKGNFPAEHTLNGLKIVVDCA
HGATYHIAPSVFRELGAEVITIGDKPDGININHEVGATSMGKIRETVIAEKADLGIALDG
DGDRIMMVNRHGKVIDGDEILYILACDAQDRGVLKGGVVGTLMSNLGLDLALKARDIPFA
RSKVGDRYVMELLKEKDWRIGGENSGHILNLDHGTTGDGIVAGILVLAAMCRKQATLEEL
TEGIKMLPQVLVNVRFEGTHNPLEADSVLSAQAEVEAKLGERGRVLLRKSGTEPLIRVMV
EGDVASDVKAHANYIAEAIKALV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory