Comparing 5210407 FitnessBrowser__PV4:5210407 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
63% identity, 97% coverage: 13:373/374 of query aligns to 7:366/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
62% identity, 97% coverage: 13:373/374 of query aligns to 5:364/365 of 2j5tD
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
55% identity, 96% coverage: 13:372/374 of query aligns to 5:323/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
54% identity, 96% coverage: 13:372/374 of query aligns to 5:321/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
38% identity, 62% coverage: 11:242/374 of query aligns to 1:219/241 of 2akoA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
35% identity, 69% coverage: 6:262/374 of query aligns to 7:257/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
34% identity, 69% coverage: 6:262/374 of query aligns to 7:235/236 of 7f5xA
>5210407 FitnessBrowser__PV4:5210407
MSMNLSEIGYRRVVVKLGTSVLTSGSRQLDKAHMVELARQMAKLMKSGVEVVLCTSGAIA
AGREHLGYPTLPDTVANKQLLAAVGQSQLILAWSQLFSIYGLHVGQLLLTRADLHDRERY
LNARDSLNALLANGIIPIINENDAVATNEIKVGDNDNLSARAALLCDADLLILLTDQKGL
FDADPRANPDAKLIKQVVNIDDSLRSLAGGAVSGLGTGGMATKLQAADIARRAGVEVVIA
SGHHPKVILDAVCQLPVGTHFTALENPLESRKQWILAGPATKGRLVLDSGAINAVTLKGR
SLLSKGIVSVSGVFDRGATLQLVDEQGREHARGMSRYSAKDLQKIAGKHSDEIESLLGYD
YGDAIVHRNDMVVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory