SitesBLAST
Comparing 5210419 FitnessBrowser__PV4:5210419 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RWZ3 Probable acyl-CoA dehydrogenase IBR3; Protein INDOLE-3-BUTYRIC ACID RESPONSE 3; EC 1.3.99.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
53% identity, 90% coverage: 20:408/432 of query aligns to 405:815/824 of Q8RWZ3
Sites not aligning to the query:
- 229 H→Y: In ibr3-11; resistance to the inhibitory effect of intermediate levels of indole-3-butyric acid (IBA) on root elongation.
Q709F0 Acyl-CoA dehydrogenase family member 11; ACAD-11; EC 1.3.8.- from Homo sapiens (Human)
53% identity, 96% coverage: 7:422/432 of query aligns to 365:779/780 of Q709F0
- 504:514 (vs. 147:157, 91% identical) binding in other chain
- WSS 538:540 (≠ YIS 181:183) binding in other chain
- R657 (= R299) binding
- Q727 (= Q369) binding in other chain
- QVCGG 727:731 (≠ QLHGG 369:373) binding
- PDE 756:758 (≠ PDQ 398:400) binding in other chain
2wbiB Crystal structure of human acyl-coa dehydrogenase 11
55% identity, 89% coverage: 31:413/432 of query aligns to 16:393/398 of 2wbiB
- active site: M133 (= M149), T134 (= T150), G253 (= G273), D376 (= D396), T388 (≠ R408)
- binding flavin-adenine dinucleotide: M133 (= M149), T134 (= T150), A139 (= A155), S140 (= S156), S141 (= S157), W165 (≠ Y181), S167 (= S183), H220 (= H240), R279 (= R299), F282 (= F302), H289 (≠ Q309), Q349 (= Q369), V350 (≠ L370), G352 (= G372), G353 (= G373), V371 (≠ S391), L374 (= L394), P378 (= P398), E380 (≠ Q400)
4hr3A Structure of a putative acyl-coa dehydrogenase from mycobacterium abscessus (see paper)
52% identity, 89% coverage: 17:402/432 of query aligns to 1:394/407 of 4hr3A
- active site: M142 (= M149), T143 (= T150), G265 (= G273), D388 (= D396)
- binding flavin-adenine dinucleotide: F140 (= F147), M142 (= M149), T143 (= T150), A148 (= A155), S149 (= S156), S150 (= S157), W174 (≠ Y181), T176 (≠ S183), H232 (= H240), L386 (= L394), A387 (= A395), P390 (= P398), E392 (≠ Q400)
Sites not aligning to the query:
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
32% identity, 91% coverage: 18:412/432 of query aligns to 5:378/378 of 5ol2F
- active site: L124 (≠ M149), T125 (= T150), G241 (= G273), G374 (≠ R408)
- binding calcium ion: E29 (≠ Q46), E33 (≠ G50), R35 (= R52)
- binding coenzyme a persulfide: L238 (= L270), R242 (= R274), E362 (≠ D396), G363 (= G397)
- binding flavin-adenine dinucleotide: F122 (= F147), L124 (≠ M149), T125 (= T150), P127 (= P152), T131 (≠ S157), F155 (≠ Y181), I156 (= I182), T157 (≠ S183), E198 (≠ M228), R267 (= R299), F270 (= F302), L274 (= L306), F277 (≠ Q309), Q335 (= Q369), L336 (= L370), G338 (= G372), G339 (= G373), Y361 (≠ A395), T364 (≠ P398), E366 (≠ Q400)
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
29% identity, 92% coverage: 13:410/432 of query aligns to 2:378/378 of 4n5fA
- active site: L126 (≠ M149), T127 (= T150), G243 (= G273), E364 (≠ D396), R376 (= R408)
- binding dihydroflavine-adenine dinucleotide: L126 (≠ M149), T127 (= T150), G132 (≠ S156), S133 (= S157), F157 (≠ Y181), T159 (≠ S183), T210 (≠ D235), Y363 (≠ A395), T366 (≠ P398), E368 (≠ Q400), M372 (= M404)
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
30% identity, 91% coverage: 20:410/432 of query aligns to 11:376/379 of 1ukwB
- active site: L124 (≠ M149), S125 (≠ T150), T241 (≠ G273), E362 (≠ D396), R374 (= R408)
- binding cobalt (ii) ion: D145 (= D171), H146 (≠ E172)
- binding flavin-adenine dinucleotide: F122 (= F147), L124 (≠ M149), S125 (≠ T150), G130 (≠ S156), S131 (= S157), W155 (≠ Y181), S157 (= S183), K200 (≠ V230), L357 (≠ S391), Y361 (≠ A395), E362 (≠ D396), T364 (≠ P398), E366 (≠ Q400), L370 (≠ M404)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
30% identity, 91% coverage: 20:410/432 of query aligns to 11:376/379 of 1ukwA
- active site: L124 (≠ M149), S125 (≠ T150), T241 (≠ G273), E362 (≠ D396), R374 (= R408)
- binding flavin-adenine dinucleotide: F122 (= F147), L124 (≠ M149), S125 (≠ T150), G130 (≠ S156), S131 (= S157), W155 (≠ Y181), S157 (= S183), L357 (≠ S391), Y361 (≠ A395), E362 (≠ D396), T364 (≠ P398), E366 (≠ Q400), L370 (≠ M404)
4m9aB Crystal structure of acyl-coa dehydrogenase from burkholderia thailandensis e264
30% identity, 88% coverage: 30:410/432 of query aligns to 17:376/376 of 4m9aB
- active site: L124 (≠ M149), T125 (= T150), G241 (= G273), E362 (≠ D396), R374 (= R408)
- binding dihydroflavine-adenine dinucleotide: F122 (= F147), T125 (= T150), G130 (≠ S156), S131 (= S157), F155 (≠ Y181), T157 (≠ S183), T208 (≠ D235), Y361 (≠ A395), T364 (≠ P398), E366 (≠ Q400), M370 (= M404)
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
28% identity, 93% coverage: 13:413/432 of query aligns to 1:380/380 of 4l1fA
- active site: L125 (≠ M149), T126 (= T150), G242 (= G273), E363 (≠ D396), R375 (= R408)
- binding coenzyme a persulfide: T132 (≠ S157), H179 (≠ K206), F232 (= F263), M236 (≠ Q267), E237 (≠ G268), L239 (= L270), D240 (≠ G271), R243 (= R274), Y362 (≠ A395), E363 (≠ D396), G364 (= G397), R375 (= R408)
- binding flavin-adenine dinucleotide: F123 (= F147), L125 (≠ M149), T126 (= T150), G131 (≠ S156), T132 (≠ S157), F156 (≠ Y181), I157 (= I182), T158 (≠ S183), R268 (= R299), Q270 (≠ A301), F271 (= F302), I275 (≠ L306), F278 (≠ Q309), L281 (≠ V312), Q336 (= Q369), I337 (≠ L370), G340 (= G373), I358 (≠ S391), Y362 (≠ A395), T365 (≠ P398), Q367 (= Q400)
- binding 1,3-propandiol: L5 (≠ F17), Q10 (= Q22)
7szvA Crystal structure of acyl-coa dehydrogenase from mycobacterium marinum in complex with fda
30% identity, 81% coverage: 61:410/432 of query aligns to 37:370/372 of 7szvA
- binding dihydroflavine-adenine dinucleotide: L122 (≠ M149), T123 (= T150), F153 (≠ Y181), I154 (= I182), T155 (≠ S183), K194 (≠ V230), R261 (= R299), S263 (≠ A301), Y271 (≠ Q309), I274 (≠ V312), Q329 (= Q369), V330 (≠ L370), G332 (= G372), G333 (= G373), T358 (≠ P398), E360 (≠ Q400)
1bucA Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
33% identity, 67% coverage: 124:412/432 of query aligns to 103:383/383 of 1bucA
- active site: L128 (≠ M149), T129 (= T150), G246 (= G273), E367 (≠ D396), G379 (≠ R408)
- binding acetoacetyl-coenzyme a: F126 (= F147), G134 (≠ S156), T135 (≠ S157), T162 (≠ S183), N182 (= N205), H183 (≠ K206), F236 (= F263), M240 (≠ Q267), M241 (≠ G268), L243 (= L270), D244 (≠ G271), T317 (≠ A344), Y366 (≠ A395), E367 (≠ D396), G368 (= G397)
- binding flavin-adenine dinucleotide: F126 (= F147), L128 (≠ M149), T129 (= T150), G134 (≠ S156), T135 (≠ S157), F160 (≠ Y181), T162 (≠ S183), Y366 (≠ A395), T369 (≠ P398), E371 (≠ Q400), M375 (= M404)
Sites not aligning to the query:
Q06319 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; BCAD; SCAD; EC 1.3.8.1 from Megasphaera elsdenii (see paper)
33% identity, 67% coverage: 124:412/432 of query aligns to 103:383/383 of Q06319
- E367 (≠ D396) active site, Proton acceptor; mutation to Q: Loss of activity.
7p9aA Structure of cyclohex-1-ene-1-carboxyl-coa dehydrogenase complexed with cyclohex-1,5-diene-1-carboxyl-coa (see paper)
31% identity, 79% coverage: 70:410/432 of query aligns to 48:377/380 of 7p9aA
- binding 1,5 Dienoyl-CoA: S131 (= S157), L133 (≠ A159), K178 (= K206), F231 (= F263), M235 (≠ Q267), L238 (= L270), N241 (≠ G273), R242 (= R274), Y362 (≠ A395), T363 (≠ D396), G364 (= G397), R375 (= R408)
- binding flavin-adenine dinucleotide: L122 (≠ F147), A124 (≠ M149), T125 (= T150), G130 (≠ S156), S131 (= S157), F155 (≠ Y181), I156 (= I182), T157 (≠ S183), K200 (≠ P237), N208 (≠ H240), L358 (≠ S391), T365 (≠ P398), Q367 (= Q400), I368 (≠ V401)
4iv6B X-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
31% identity, 84% coverage: 61:422/432 of query aligns to 37:378/383 of 4iv6B
- active site: L121 (≠ M149), T122 (= T150), G240 (= G273), E361 (≠ D396), K373 (≠ Q417)
- binding dihydroflavine-adenine dinucleotide: L121 (≠ M149), T122 (= T150), G126 (≠ A155), G127 (≠ S156), S128 (= S157), W152 (≠ Y181), I153 (= I182), S154 (= S183), R266 (= R299), S268 (≠ A301), F269 (= F302), I273 (≠ L306), H276 (≠ Q309), V279 (= V312), R334 (≠ Q369), V335 (≠ L370), G338 (= G373), L356 (≠ S391), G360 (≠ A395), T363 (≠ P398), E365 (≠ Q400), I366 (≠ V401)
7p9xA Structure of cyclohex-1-ene-1-carboxyl-coa dehydrogenase complexed with cyclohex-1-ene-1-carboxyl-coa (see paper)
31% identity, 79% coverage: 70:410/432 of query aligns to 46:375/378 of 7p9xA
- binding 1-monoenoyl-CoA: L82 (≠ V108), D89 (= D115), S129 (= S157), L131 (≠ A159), K176 (= K206), F229 (= F263), M233 (≠ Q267), L236 (= L270), R240 (= R274), Y360 (≠ A395), T361 (≠ D396), G362 (= G397), R373 (= R408)
- binding flavin-adenine dinucleotide: A122 (≠ M149), T123 (= T150), G128 (≠ S156), S129 (= S157), F153 (≠ Y181), I154 (= I182), T155 (≠ S183), N206 (≠ H240), L356 (≠ S391), Y360 (≠ A395), T363 (≠ P398), Q365 (= Q400), I366 (≠ V401)
8sgsA Short-chain specific acyl-CoA dehydrogenase, mitochondrial (see paper)
31% identity, 80% coverage: 70:413/432 of query aligns to 48:379/381 of 8sgsA
- binding coenzyme a: S131 (= S157), A133 (= A159), N177 (= N205), F231 (= F263), M235 (≠ Q267), L238 (= L270), I312 (≠ K346), E362 (≠ D396), G363 (= G397)
- binding flavin-adenine dinucleotide: F122 (= F147), L124 (≠ M149), S125 (≠ T150), G130 (≠ S156), S131 (= S157), W155 (≠ Y181), T157 (≠ S183), R267 (= R299), F270 (= F302), L274 (= L306), L277 (≠ Q309), Q335 (= Q369), I336 (≠ L370), G338 (= G372), G339 (= G373), I357 (≠ S391), I360 (≠ L394), Y361 (≠ A395), T364 (≠ P398), E366 (≠ Q400)
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
31% identity, 80% coverage: 70:413/432 of query aligns to 51:382/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (≠ G374), T347 (≠ Q378), E348 (≠ D379)
- binding flavin-adenine dinucleotide: F125 (= F147), L127 (≠ M149), S128 (≠ T150), G133 (≠ S156), S134 (= S157), W158 (≠ Y181), T160 (≠ S183), R270 (= R299), F273 (= F302), L280 (≠ Q309), V282 (≠ S311), Q338 (= Q369), I339 (≠ L370), G342 (= G373), I360 (≠ S391), Y364 (≠ A395), T367 (≠ P398), E369 (≠ Q400), I370 (≠ V401), L373 (≠ M404)
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
31% identity, 80% coverage: 70:413/432 of query aligns to 54:385/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (= F147), L130 (≠ M149), S131 (≠ T150), G136 (≠ S156), S137 (= S157), W161 (≠ Y181), T163 (≠ S183), T214 (≠ E238), R273 (= R299), F276 (= F302), L280 (= L306), L283 (≠ Q309), V285 (≠ S311), Q341 (= Q369), I342 (≠ L370), G345 (= G373), I363 (≠ S391), Y367 (≠ A395), T370 (≠ P398), E372 (≠ Q400), L376 (≠ M404)
P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 3 papers)
31% identity, 80% coverage: 70:413/432 of query aligns to 78:409/412 of P16219
- G90 (≠ S84) to S: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908005
- E104 (≠ I98) natural variant: Missing (in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs387906308)
- 152:161 (vs. 147:157, 36% identical) binding in other chain
- R171 (≠ V167) to W: 69% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1800556
- WIT 185:187 (≠ YIS 181:183) binding in other chain
- A192 (≠ N188) to V: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940874
- G209 (≠ Y207) to S: 86% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1799958
- R297 (= R299) binding
- Q308 (= Q310) binding in other chain
- R325 (= R327) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908006
- S353 (≠ P357) to L: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28941773
- QILGG 365:369 (≠ QLHGG 369:373) binding
- R380 (≠ K384) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940875
- TSE 394:396 (≠ PDQ 398:400) binding in other chain
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
Query Sequence
>5210419 FitnessBrowser__PV4:5210419
MGFGQLQLKESTMNFEFSPKVQALRERLLAFMDEHIYPNESLWEQQVEEGDRWESPAILA
ELKAKAKDAGLWNLFLPQVYGEFSPGLTNLEYAPLAEIMGRVYWASEVFNCSAPDTGNME
VLARYGNKEQQERWLQPLLNGEIRSAFSMTEPDVASSDATNVETSIVRDGDEYVINGRKW
YISGACNNHTQIHIVMGKTDPDNSNKYIQQSMILVPANTPGVKVVRPMKVFGYDDAPEGH
AEVIYDNVRVPVSNMLLGEGRGFEIAQGRLGPGRIHHCMRTVGLAQRALEQMCERAETRI
AFGKPLSKQQSVREAIAKSACEVEQARLLTLKAAAKMDQGGNKAAKDLIAMIKIVAPNMG
CAVIDRAIQLHGGGGLSQDFFLAKAYTITRSIRLADGPDQVHMMQLGRNLARDVHAQNLA
AQHPAKPVGAVS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory