SitesBLAST
Comparing 5210421 Shew_2862 short chain dehydrogenase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
41% identity, 97% coverage: 7:253/255 of query aligns to 3:246/249 of 3uf0A
- active site: G18 (= G22), S141 (= S148), V151 (≠ Q158), Y154 (= Y161), K158 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G18), S17 (≠ R21), G18 (= G22), I19 (= I23), R39 (= R43), D63 (≠ H68), L64 (≠ V69), N89 (= N95), G91 (vs. gap), I92 (vs. gap), I139 (≠ T146), A140 (= A147), S141 (= S148), Y154 (= Y161), K158 (= K165), P184 (= P191), G185 (= G192), V187 (≠ T194), T189 (= T196), N191 (≠ F198), T192 (≠ A199)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
38% identity, 98% coverage: 6:254/255 of query aligns to 1:250/252 of 1vl8B
- active site: G17 (= G22), S143 (= S148), I154 (= I160), Y157 (= Y161), K161 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G18), R16 (= R21), G17 (= G22), L18 (≠ I23), S37 (= S42), R38 (= R43), C63 (= C67), D64 (≠ H68), V65 (= V69), A91 (≠ N95), A92 (= A96), G93 (≠ A97), I94 (≠ T98), V114 (= V119), I141 (≠ T146), S143 (= S148), Y157 (= Y161), K161 (= K165), P187 (= P191), G188 (= G192), Y190 (≠ T194), T192 (= T196), M194 (≠ F198), T195 (≠ A199)
2zatA Crystal structure of a mammalian reductase (see paper)
39% identity, 96% coverage: 9:252/255 of query aligns to 3:246/251 of 2zatA
- active site: G16 (= G22), S142 (= S148), L152 (≠ Q158), Y155 (= Y161), K159 (= K165), K200 (≠ D206)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A12 (≠ G18), T14 (≠ S20), D15 (≠ R21), G16 (= G22), I17 (= I23), S36 (= S42), R37 (= R43), K38 (= K44), N41 (≠ G47), H62 (= H68), N89 (= N95), A91 (= A97), V140 (≠ T146), S142 (= S148), Y155 (= Y161), K159 (= K165), P185 (= P191), G186 (= G192), I188 (≠ T194), T190 (= T196), F192 (= F198), S193 (≠ A199)
Q8WNV7 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; PHCR; NADPH-dependent retinol dehydrogenase/reductase; NDRD; Peroxisomal carbonyl reductase; PerCR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; EC 1.1.1.184; EC 1.1.1.300 from Sus scrofa (Pig) (see 2 papers)
39% identity, 96% coverage: 9:252/255 of query aligns to 31:274/279 of Q8WNV7
- 37:61 (vs. 15:39, 60% identical) binding
- F177 (≠ G155) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to S: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with F-180.
- L180 (≠ Q158) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to F: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with S-177.
- Y183 (= Y161) active site, Proton acceptor
- K187 (= K165) binding
- N196 (≠ A174) Important for the maintenance of the quaternary structure, the catalytic activity and cold stability
Sites not aligning to the query:
- 277:279 Peroxisomal targeting signal
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
38% identity, 96% coverage: 9:252/255 of query aligns to 30:273/278 of Q9BTZ2
- S176 (≠ G155) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (≠ Q158) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (≠ A174) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
38% identity, 96% coverage: 9:252/255 of query aligns to 6:249/254 of 3o4rA
- active site: G19 (= G22), S145 (= S148), F155 (≠ Q158), Y158 (= Y161), K162 (= K165), K203 (≠ D206)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G18), T17 (≠ S20), D18 (≠ R21), G19 (= G22), I20 (= I23), S39 (= S42), R40 (= R43), K41 (= K44), N44 (≠ G47), H65 (= H68), V66 (= V69), N92 (= N95), A94 (= A97), S145 (= S148), Y158 (= Y161), K162 (= K165), P188 (= P191), G189 (= G192), L190 (≠ F193), I191 (≠ T194), T193 (= T196), F195 (= F198), S196 (≠ A199)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 97% coverage: 9:255/255 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G22), S142 (= S148), Q152 (= Q158), Y155 (= Y161), K159 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (= S20), R15 (= R21), G16 (= G22), I17 (= I23), N35 (≠ A41), Y36 (vs. gap), N37 (≠ S42), G38 (≠ R43), S39 (≠ K44), N63 (≠ H68), V64 (= V69), N90 (= N95), A91 (= A96), I93 (≠ T98), I113 (≠ V119), S142 (= S148), Y155 (= Y161), K159 (= K165), P185 (= P191), I188 (≠ T194), T190 (= T196)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
39% identity, 97% coverage: 6:253/255 of query aligns to 3:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G18), S17 (= S20), R18 (= R21), I20 (= I23), T40 (≠ R43), N62 (≠ H68), V63 (= V69), N89 (= N95), A90 (= A96), I92 (≠ T98), V139 (≠ T146), S141 (= S148), Y154 (= Y161), K158 (= K165), P184 (= P191), G185 (= G192), I187 (≠ T194), T189 (= T196), M191 (≠ F198)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
37% identity, 95% coverage: 12:253/255 of query aligns to 6:251/256 of 7do7A
- active site: G16 (= G22), S146 (= S148), Y159 (= Y161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), R15 (= R21), G16 (= G22), I17 (= I23), S37 (≠ R43), D66 (≠ H68), A67 (≠ V69), N93 (= N95), A94 (= A96), G95 (≠ A97), I96 (≠ T98), V144 (≠ T146), S145 (≠ A147), S146 (= S148), Y159 (= Y161), K163 (= K165), P189 (= P191), G190 (= G192), I192 (≠ T194), T194 (= T196), I196 (≠ F198)
- binding beta-L-rhamnopyranose: F99 (= F102), S146 (= S148), S148 (≠ N150), Q156 (= Q158), Y159 (= Y161), N197 (≠ A199), D235 (= D237), M236 (≠ A238), R238 (≠ S240)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
37% identity, 95% coverage: 12:253/255 of query aligns to 6:251/256 of 7b81A
- active site: G16 (= G22), S146 (= S148), Y159 (= Y161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), S14 (= S20), R15 (= R21), I17 (= I23), D66 (≠ H68), A67 (≠ V69), N93 (= N95), A94 (= A96), G95 (≠ A97), I96 (≠ T98), T116 (≠ V119), V144 (≠ T146), S146 (= S148), Y159 (= Y161), K163 (= K165), P189 (= P191), G190 (= G192), I192 (≠ T194), T194 (= T196), I196 (≠ F198)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
38% identity, 97% coverage: 6:253/255 of query aligns to 3:240/243 of 4i08A
- active site: G19 (= G22), N113 (= N120), S141 (= S148), Q151 (= Q158), Y154 (= Y161), K158 (= K165)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G18), S17 (= S20), R18 (= R21), I20 (= I23), T40 (≠ R43), N62 (≠ H68), V63 (= V69), N89 (= N95), A90 (= A96), G140 (≠ A147), S141 (= S148), Y154 (= Y161), K158 (= K165), P184 (= P191), G185 (= G192), T189 (= T196)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
38% identity, 97% coverage: 7:253/255 of query aligns to 1:241/244 of 6t77A
- active site: G16 (= G22), S138 (= S148), Y151 (= Y161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (= S20), R15 (= R21), T37 (≠ R43), L58 (≠ C67), N59 (≠ H68), V60 (= V69), A87 (= A96), G88 (≠ A97), I89 (≠ T98)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 98% coverage: 7:255/255 of query aligns to 1:243/244 of P0AEK2
- GASR 12:15 (= GASR 18:21) binding
- T37 (≠ R43) binding
- NV 59:60 (≠ HV 68:69) binding
- N86 (= N95) binding
- Y151 (= Y161) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSISK 161:165) binding
- A154 (≠ S164) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K165) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ T194) binding
- E233 (= E245) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
37% identity, 97% coverage: 8:255/255 of query aligns to 1:242/243 of 1q7bA
- active site: G15 (= G22), E101 (≠ D109), S137 (= S148), Q147 (= Q158), Y150 (= Y161), K154 (= K165)
- binding calcium ion: E232 (= E245), T233 (= T246)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G18), S13 (= S20), R14 (= R21), T36 (≠ R43), N58 (≠ H68), V59 (= V69), N85 (= N95), A86 (= A96), G87 (≠ A97), I88 (≠ T98), S137 (= S148), Y150 (= Y161), K154 (= K165), P180 (= P191), G181 (= G192), I183 (≠ T194)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
37% identity, 97% coverage: 8:255/255 of query aligns to 1:242/243 of 1q7cA
- active site: G15 (= G22), S137 (= S148), Q147 (= Q158), F150 (≠ Y161), K154 (= K165)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G18), S13 (= S20), R14 (= R21), A35 (≠ S42), T36 (≠ R43), L57 (≠ C67), N58 (≠ H68), V59 (= V69), G87 (≠ A97), I88 (≠ T98)
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
36% identity, 95% coverage: 12:253/255 of query aligns to 6:242/247 of 7do6A
- active site: G16 (= G22), S146 (= S148), Y159 (= Y161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (= S20), R15 (= R21), G16 (= G22), I17 (= I23), H36 (≠ S42), S37 (≠ R43), G42 (vs. gap), D66 (≠ H68), A67 (≠ V69), N93 (= N95), A94 (= A96), G95 (≠ A97), I96 (≠ T98), T116 (≠ V119), S146 (= S148), Y159 (= Y161), K163 (= K165), I192 (≠ F203)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
37% identity, 97% coverage: 9:255/255 of query aligns to 6:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G18), R18 (= R21), G19 (= G22), I20 (= I23), D39 (≠ S42), R40 (= R43), C63 (= C67), I65 (≠ V69), N91 (= N95), G93 (≠ A97), I94 (≠ T98), V114 (= V119), Y155 (= Y161), K159 (= K165), I188 (≠ T194), T190 (= T196), T193 (≠ A199)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
36% identity, 97% coverage: 7:254/255 of query aligns to 12:258/261 of 5u9pB
- active site: G27 (= G22), S152 (= S148), Y165 (= Y161), K169 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G18), R26 (= R21), G27 (= G22), I28 (= I23), R48 (= R43), D73 (≠ H68), V74 (= V69), N100 (= N95), A101 (= A96), I150 (≠ T146), Y165 (= Y161), K169 (= K165), P195 (= P191), F198 (≠ T194), T200 (= T196), L202 (≠ F198), N203 (≠ A199)
3tzcA Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(y155f) from vibrio cholerae (see paper)
38% identity, 97% coverage: 6:253/255 of query aligns to 3:223/224 of 3tzcA
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 98% coverage: 7:255/255 of query aligns to 1:243/244 of P0A2C9
- M125 (= M135) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ V235) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S236) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
Query Sequence
>5210421 Shew_2862 short chain dehydrogenase (RefSeq)
MDNKSLFDLSGRIALVTGASRGIGAAIAELLAAYGAHVIVASRKAEGCQTVAEQIIDNGG
SAEAMACHVGDLEAIQATFEQIQAKHGRLDILVNNAATNPYFGHILDTDLNAFNKTMEVN
LRGYFFMSVTAGRMMREQGHGVILNTASVNALQPGEMQGIYSISKAAVVSMTKAFAKECA
PLGIRCNALLPGFTKTQFAGALFNNDKIYQQLIARIPMGRHAVPSEMAGAVLYLVSDASS
YTTGETLVVDGGLTL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory